KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1987Help
Entry
ABTW07_1987       CDS       T01908                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ABTW07_1987
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ABTW07_1987
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ABTW07_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2109108..2109893
Genome map
AA seq 261 aa AA seqDB search
MTKLLDGKVAFITGSASGIGLEIAKKFAQEGAKVVISDMNAEKCQETANSLKERGFDALS
APCDVTDEDNYKQAIELTQKTFGTVDILINNAGFQHVASIEEFPTAVFQKLVQVMLTGAF
IGIKHVFPIMKAQKYGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALECARDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSLDSALEDVILAMVPQKRLLSVEEIADYAIFLA
SEKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacttttagacggtaaggtcgcttttattacaggttctgcaagtggtatcggt
ctagagattgctaagaaatttgctcaagaaggtgccaaagttgttatttctgatatgaat
gctgaaaagtgtcaagaaacagcaaactcacttaaagagcgaggttttgatgcattatct
gcaccatgtgatgtgactgatgaagataattataaacaagccattgagcttactcaaaag
acctttggtacggttgatatcttaattaataatgctggtttccaacatgttgcatctatt
gaagaatttccaacggctgtttttcaaaagttagttcaagtcatgttaactggggcattt
attggtattaaacatgtttttccaatcatgaaagctcagaaatatggtcgtattattaat
atggcttcaattaatggcttgattggtttcgctggaaaggcaggttataacagcgctaaa
catggtgtgatcggtctaacaaaagttgccgcattagaatgtgcacgtgatggtattacg
gtaaatgctttatgtccggggtatgtagatacaccattggttcgtgggcaaattgcagat
ttggctaaaacccgtaatgtaagtttagacagtgcacttgaggatgtaattttggcaatg
gttcctcaaaagcgtttgctatctgttgaagaaatcgctgattatgcaattttccttgcg
agtgaaaaagcaggtggggtaacaggccaagctgtcgtgatggatggcggttatacggcc
caataa

DBGET integrated database retrieval system