KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2300Help
Entry
ABTW07_2300       CDS       T01908                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00900  Terpenoid backbone biosynthesis
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABTW07_2300
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ABTW07_2300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3 RMMBL
Motif
Other DBs
NCBI-ProteinID: ADX92724
Structure
PDB: 

Jmol
Position
complement(2448386..2449561)
Genome map
AA seq 391 aa AA seqDB search
MGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIVELKT
LFAQQNISDIDVLAGQEGLVDIASHTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKE
ALVMSGEIMMQAARDHQALLLPVDSEHNAIFQSLPHNYLQADRTGQPQLGVSKILLTASG
GPFLNHSLEQLTHVTPQQACKHPNWSMGQKISVDSATLMNKGLELIEACHLFSISEHFVT
VVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHALAWPERLQTNVPALDLFEYSQLNF
QAPDTQKFPALNLARQAMRAGGLAPTILNAANEIAVEAFLMERIGFTSIPQVVEHTLEKL
ENAAAESIECILDKDKVARSVAQQYISSIGG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgtaaccggttctattggacgaagtaccttaaaaattttaggtcaacatccagat
aagtattcagtctttgcagtttcggcgcatagtcgaatttctgaacttgttgaaatctgc
aaacagtttcgacctaaagttgttgttgttcctgaacagaaaatagttgaactaaaaaca
ctatttgctcagcaaaatatatcggatattgatgttttagctgggcaagagggtttagtc
gatatcgcatctcatactgatgtggatattgttatggcggcaattgtaggggcagctggg
ctgttgccaactttagcggctgttaaggcaggtaaaagagtactacttgccaacaaagaa
gcattagttatgtctggtgaaatcatgatgcaagctgctcgtgatcatcaggcattgtta
ttgccagttgattcggaacataatgcaattttccaatcattgcctcataattatttacaa
gcagatagaacagggcaaccacagctaggtgtatctaaaatattgcttacagcatctggt
ggtccctttttaaatcactccttagaacaattgactcatgtaacgccgcaacaagcatgt
aaacatccaaactggtcaatgggacaaaaaatttcggttgactcagctactcttatgaat
aaagggttagagttaatagaggcttgtcatttattttcaatatctgaacattttgttaca
gttgttgttcatccacaaagtatcattcactctatggtgcagtatgttgatggttcaaca
ttagcacaaatgggtaacccggatatgtgtactccgattgcacatgcattggcatggcct
gagcgtttacaaactaatgtacctgctttagatttatttgagtattctcaacttaatttt
caggcaccagatacccaaaaatttcctgcattaaatttggctagacaagcaatgcgtgcg
ggaggtttggcaccaaccattttgaatgcagctaatgaaattgcagttgaagcattctta
atggaaaggattggatttacaagtattccgcaagtggtagagcatactttggaaaaatta
gagaatgcagcggctgaaagcatcgagtgcattttagataaagataaagtggctcgatct
gtagctcagcaatatatatcaagtattggaggctga

DBGET integrated database retrieval system