KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2427Help
Entry
ABTW07_2427       CDS       T01908                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2570608..2571537
Genome map
AA seq 309 aa AA seqDB search
MVKSSLCVNRLDNYGAFGIKPKLRRCLSCTEIIIIEAPMNKSLIIFGIVNITSDSFSDGG
RYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPV
SLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAP
AGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRF
DLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLA
ALKETARIR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtcttctttatgcgtgaacaggctcgacaattatggagcttttggaataaag
ccaaagctcaggcggtgcttatcgtgtacagagattattattatagaagcccccatgaat
aaatcgctcatcattttcggcatcgtcaacataacctcggacagtttctccgatggaggc
cggtatctggcgccagacgcagccattgcgcaggcgcgtaagctgatggccgagggggca
gatgtgatcgacctcggtccggcatccagcaatcccgacgccgcgcctgtttcgtccgac
acagaaatcgcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcattcccgtc
tcgctcgacagttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtggcctat
ctcaatgatattcgcggttttccagacgctgcgttctatccgcaattggcgaaatcatct
gccaaactcgtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgaggcaccc
gctggcgacatcatggatcacattgcggcgttctttgacgcgcgcatcgcggcgctgacg
ggtgccggtatcaaacgcaaccgccttgtccttgatcccggcatggggttttttctgggg
gctgctcccgaaacctcgctctcggtgctggcgcggttcgatgaattgcggctgcgcttc
gatttgccggtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcacaggccgt
ggtccgggggatgtcggggccgcgacactcgctgcagagcttgccgccgccgcaggtgga
gctgacttcatccgcacacacgagccgcgccccttgcgcgacgggctggcggtattggcg
gcgctgaaagaaaccgcaagaattcgttaa

DBGET integrated database retrieval system