KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2812Help
Entry
ABTW07_2812       CDS       T01908                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2982861..2983415
Genome map
AA seq 184 aa AA seqDB search
MSMQQSYANILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVFPSDNHE
MVLVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQ
IAEAVAEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAV
PESY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgcagcaatcgtacgcaaatattctgactgccgtcggtgaagaccttaatcgt
cccggccttaaagatacgcctgtgcgtgcggctaaagctttttcatatttaacttctggc
tatagtaaaactttagaagaagtcaccaataatgctgttttcccatcagataaccatgaa
atggtattggtgaagaatattgaattttattcgctctgcgaacaccatcttctcccattc
tatggccgtgttcatgttgcctatttaccagaaggcaaagttcttggcttatctaaattt
gcacgtattaccgagatgtttgctcgtcgtttgcaaattcaggaaaaccttactcagcaa
atcgctgaagctgttgcagaagtgactggtgctcgtggcgttgctgtagtcatcgattca
gcacatatgtgtatgatgatgcgtggtgtaggtaaacaagaatctaccacccgtacagtt
tcatttgtcggagattttaaaaccgataaagaagcgcgccgtgaattcttaagtgcagta
ccagaaagctactaa

DBGET integrated database retrieval system