KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3135Help
Entry
ABTW07_3135       CDS       T01908                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ABTW07_3135
Enzymes [BR:abd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ABTW07_3135
Exosome [BR:abd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABTW07_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3342492..3344000)
Genome map
AA seq 502 aa AA seqDB search
MSNCPKKYIVAFDQGTTSSRAIVLDHDANVVSIAQREFTQIYPQPGWVEHDPMEIWATQS
AVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQTTEICNQLYK
AGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDTWLIWKLTNGA
VHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYTHTISGQEVGI
PIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLLTTIACGASGE
VNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPAFTGLGAPYWD
PTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLRVDGGVTENNF
LMQFQADILATPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIEKVFEPKMSSE
QSEMIYKGWLKAVKRSQSWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattgcccgaaaaaatatattgtcgcttttgatcagggaacaacaagctcaaga
gcaattgttttagatcatgatgcgaacgttgtcagtattgctcaaagagaatttacccag
atttaccctcagccaggttgggttgagcatgatcctatggaaatttgggcaactcaaagt
gctgtatgggtcgaagcattggctcaagctggcatcaagagtgaacaagttgcggcaatt
ggaattacaaaccaacgggaaaccactattgtctgggacaaaaaaacaggaagacctatt
tacaatgcgattgtttggcaaagccgacaaacaacggaaatatgcaatcaattgtataaa
gcaggttggcaagaatatatccgtaagaccactggtttagtcattgatccatatttctcg
gccacaaaaattaaatggattttggatcatgttgaaggcagccgtgagcgtgctgaacga
ggagagctattattcggtacggtggacacttggctgatttggaaactaactaatggggcc
gtccatgtcactgattttaccaatgcatctcgaaccatgctgtttgatatcgaaaagctt
gagtgggatgaaaagcttttacaagctttagacattcctagagcaatgttgccggaggtt
cgtagttcatctgaggtttatggatatacacataccattagtggacaagaagtaggaatc
ccaattgccggaatcgcgggtgatcagcaggctgcgctttttggtcaaatgtgtgttgag
tcgggacaggctaaaaatacctacggtactggctgttttctactcatgaatacgggtaaa
aagattgtccgttcagagcatggattactcacaactattgcctgtggtgcgagtggtgag
gtgaactatgccttagagggtgccgtatttaacggtggttcttgcgtacagtggttacgt
gatgaattaaaggttattaagaatgctaaggattccgagctttatgcaacacgtgtaaag
gataataatggtgtatatgtagtacctgcttttaccgggttaggagcaccgtattgggac
ccgacagctcgcggcgcaatttttggtctgacgcgtggggctagtattgaacatattatc
cgcgcaactctagagtctatagcctttcaaactcgggatgttttagatgccatgcaacaa
gatgcagaagaagagcttcgtacactccgtgtcgatggaggagtaacggaaaataatttc
ttaatgcaatttcaggctgatattttagcgacaccagtagaacgtccaataatgaaagaa
actactgctttgggtgcagctttccttgctgggctggcgacgggtttctggcaagatcta
catgagttaagaaataaatctgccatagaaaaggtatttgagccaaaaatgtcttctgag
caatctgagatgatttataagggttggctcaaggcagttaaacgtagtcaaagttgggct
gaggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system