KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3177Help
Entry
ABTW07_3177       CDS       T01908                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00020  Citrate cycle (TCA cycle)
abd00310  Lysine degradation
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
abd01200  Carbon metabolism
Module
abd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABTW07_3177
  Amino acid metabolism
   00310 Lysine degradation
    ABTW07_3177
Enzymes [BR:abd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABTW07_3177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF5304 GCV_H OmpA
Motif
Other DBs
NCBI-ProteinID: ADX93597
Position
complement(3392799..3393995)
Genome map
AA seq 398 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVVLEVVAPADGSLVAII
KGEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPVVERNETVSDQAPAVRK
ALTESGIAASDVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKR
VAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAATEALK
RYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVEAGIAAYAAKAR
DGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPM
MYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcataaaaaggtgggtgaacctgtatcacgtgatgaagtaatctgtgatattgaa
accgacaaagttgttttagaagttgttgctcctgcagatggtagcttggttgcaatcatt
aaaggtgaaggcgatacagttctttctgacgaagttattgctcaattcgaagctggtgct
ggcgcagcggctgctgctcctgcggcagtagaacaagcagttgctcagactcaagctggt
gctgctcctgttgttgagcgtaatgaaactgtatctgatcaagctcctgcggtacgtaaa
gcgttaactgaatctggtattgctgcttctgacgtacaaggtactggtcgtggtggtcgt
attactaaagaagatgttgcaaaccatcaagctaaaccagctgctaacgttactccatta
agcgttgctgttggcgagcgtatcgaaaaacgcgttccaatgactcgtttacgtaaacgt
gtagctgagcgtcttcttgcagctactcaagaaacagcaatgttaactacatttaacgaa
gttaacatgaagccaatcatggaattacgtaagcaatataaagatgctttcgaaaaacgt
catggtgctcgtttaggcttcatgtcattcttcgttaaagcagcaactgaagcgctaaaa
cgctacccagctgtaaatgcttcaattgatggcgatgatatcgtttatcacggttactat
gacatcggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatact
gaccgtatgagctatgcagaagttgaagcaggtattgctgcttacgctgctaaagcacgt
gatggtaaattatctatcgaagaaatgactggcggtactttcacaatcactaacggtggt
actttcggttcattactttcaactccaattttgaaccagccgcaaactggtatcttgggg
atgcataaaatccaagaacgtcctatggcggtaaatggtcaagttgaaatcttgccaatg
atgtacttagcgctttcttatgaccaccgtatgatcgatggtaaagaagctgtaggtttc
ttagtagcaatcaaagaattgttagaagaaccagctaaactcattcttgatctttaa

DBGET integrated database retrieval system