KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3194Help
Entry
ABTW07_3194       CDS       T01908                                 

Definition
(GenBank) alcohol dehydrogenase, class IV
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00010  Glycolysis / Gluconeogenesis
abd00071  Fatty acid degradation
abd00350  Tyrosine metabolism
abd00625  Chloroalkane and chloroalkene degradation
abd00626  Naphthalene degradation
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
abd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABTW07_3194
  Lipid metabolism
   00071 Fatty acid degradation
    ABTW07_3194
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABTW07_3194
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABTW07_3194
   00626 Naphthalene degradation
    ABTW07_3194
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABTW07_3194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Ufm1
Motif
Other DBs
NCBI-ProteinID: ADX93614
Position
3412532..3413716
Genome map
AA seq 394 aa AA seqDB search
MAKPYYEFFCPVKVIAGNAALEHIPFELATLGAKRPLIITDKGVRANGLLNPIEAAFSTT
DAVIGHVFDDVPPDSSLEVVRLAAEAYRTNKCDAIIAVGGGSVIDTSKATNILVSEGGDD
LLQYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDTQKNVKLAFASYYLMPHAAILD
PRMTLTLPPHLTAMTGMDALTHCVEAYTCMAANPLSDAYASAGIKKISENLFNVLENPND
SQGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEYNKQVN
GQKIGELLLPLAGADIYAQTPATQRADRAIATILAMRDRLFSLTKLPRTLRETGKVTEAQ
LDEVAEKALNDGSIIYNPKEASLKDLREILQKAW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccatattacgaattcttttgtcctgtaaaagtcattgccggtaatgctgct
ttagaacatattccgtttgaacttgcgactttaggtgcaaaacgccctcttatcattacc
gataaaggtgttcgtgcaaatggcttgttaaaccctattgaagctgcttttagcacaact
gatgcagtcattggtcatgtttttgatgatgttccaccagactcaagccttgaagttgtt
cgacttgccgcggaagcttatcgcacaaataaatgtgatgcgattattgctgtgggtggt
ggttctgttatcgatacctctaaagcaactaacattttagtatcagaaggtggagatgat
cttcttcaatattctggtgcacacaacctaccaaaaccattaaaaccatttttcgtcatc
ccgactacatcaggtacgggctctgaagtgaccatggttgctgttgtgtctgatacacaa
aagaatgttaaattggcatttgcttcatattacttaatgccacatgctgcgattttagat
ccacgcatgacattaacgttaccacctcacttaactgcaatgacgggcatggatgcatta
acacattgtgttgaagcatacacctgtatggcagctaacccgcttagcgatgcctatgca
agtgcaggtattaaaaaaattagcgaaaacctatttaatgtcttagaaaatccaaatgac
tcacaaggtcgtttagaacttgcacaagcttctacaatggcaggtatcgcattctctaac
tcgatggtaggccttgtacactcattaggacatgcattaggtgcagttgctcacctgccc
cacgggctgtgcatgaacttattcttaccttatgtgcttgagtacaataaacaagtcaat
ggtcagaaaattggcgagttgctattaccacttgcaggtgcggatatttatgcccagact
cctgctactcagcgtgcagacagagcaatcgcaactattttagcaatgcgtgatcgttta
tttagcttaaccaaattaccacgtaccttacgtgaaacaggtaaagttactgaagcacag
cttgatgaagtggcagagaaagcactaaatgatggctcaattatttataatcctaaagaa
gcaagcttaaaagatctacgagagatcttacaaaaagcttggtaa

DBGET integrated database retrieval system