KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3342Help
Entry
ABTW07_3342       CDS       T01908                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00260  Glycine, serine and threonine metabolism
abd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01130  Biosynthesis of antibiotics
abd01230  Biosynthesis of amino acids
Module
abd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABTW07_3342 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABTW07_3342 (trpB)
Enzymes [BR:abd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABTW07_3342 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADX93761
Position
complement(3575344..3576573)
Genome map
AA seq 409 aa AA seqDB search
MDQQNNVIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDL
AYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIA
ETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKD
AMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALV
ACVGGGSNAMGLFYPFLNDASVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMS
DEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPA
LESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcaaaataatgtgattgactatacccaattcccagatgcaaatgggcatttc
ggtatccatggcggacgttttgtgtcagaaactttaatggcggcattagaagatttggaa
aatctctattcccgcatgaaaaatgatgaacagtttttggcagaattcgaccgtgatctc
gcctactatgtaggtcgtcctagtccactttattatgctgagcgatggtcaaaagagtta
ggtggtgcgcaaatttaccttaaacgtgaagacttgaaccatacaggctcacacaaggta
aacaacacgattggtcaggcactacttgcaaagctttctggtaaaaaacgtattattgcc
gaaactggtgcaggccagcatggggtagcaacagcaacaattgcagcacgtttaggtctt
gaatgtgttgtttatatgggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgt
atgcgtttgttaggtgcaacagttgtgcctgtgcaaagtggctctaaaacattaaaagat
gccatgaacgaagcgatgcgtgactgggtaaccaacgttgatacaacatattatgtcatt
ggtacagttgcaggtccgcatccttatcctcaacttgttcgtgacttccaatcaattatt
ggtcgtgaagcgcgtaaacagattttggaacaagcaggtcgcttaccagatgcattagtt
gcttgtgtaggtggtggttcaaatgcaatgggcttgttttatccgttcttaaacgatgcc
agtgtaaaaatgtatggggttgaagctgctggttttggtattgaaactggtaaacactct
gcgcctttaaatgcgggtcatgtgggtgtattacatggtaaccgtacttatttaatgagt
gatgaacagggccagattattgagacacacagtatctcggcgggccttgattatccgggt
gttggtcctgaacatagtttcttgaaagatatgaagcgtgtagagtacgtgccgattaat
gatacagaggctcttcaaggtttccgtgacttaaccaaaatcgaagggattattcctgcg
cttgaaagctcgcacgcgatggcgtatgtctctaagcttgcaccgacgatgtctaaagat
cagattattattgcgactgtttcaggccgtggcgataaagacttaatgacagttgcacgc
attgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system