KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3613Help
Entry
ABTW07_3613       CDS       T01908                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABTW07_3613
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABTW07_3613
Enzymes [BR:abd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ABTW07_3613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3856382..3857881)
Genome map
AA seq 499 aa AA seqDB search
MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYSQPEKTRTFAEAALAN
GALAVISETELGVANEWVCPDVRQRMGEWQKRYLQQADVVKPLRIIAVTGTNGKTTISRL
IAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNALHDYAKQGATFASLEASS
HGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKARLFQFNSLKVAVINLDDAHA
DLMIKSAQNNPAQPKILTYSLTQNTADYYITDLSYSLAGATFNLVSQQGSFAVESPLLGH
FNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQVIRDDERLFVVDYAHTPDALIQ
VLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDGANPVILTSDNPRTEDPEQIFAD
MKQGIDFSGHRMHEIHDRREAIKFVAEQAQAGDIVVIAGKGHENYQEINGVRHWFDDVVE
VRSAIDAQHHTVDAAYPAQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcttttcaagaaattcatccaatcgaaattgatgctcaatggcctcaacag
ccatttcacggctttagtttagatagtcgtaaagttgaaacgggccaaatttttattgct
ttgacaagttatagccagcctgaaaaaacgcgtacatttgctgaagcggctttagcaaat
ggagcgttggctgtcattagcgaaaccgaattaggtgtagcaaatgaatgggtatgccct
gatgtgcgtcagcgcatgggagagtggcaaaaacgttatttgcaacaggctgatgtagta
aaacctttacggattatagctgtaacaggcacaaatggtaaaacaacaatttctcgttta
attgctgagttaattagttcacagcagcagcgctgtgcagtgatggggacaacagggaat
ggtattttacctaacttaacgccttctacgcatactaccctcgacgctctacagttacaa
aatgcgctacatgattatgctaaacagggagcaacttttgcttctttagaagcaagttca
catggtcttgaacagggtcgattaaatggttgcgatattgaaattgctgtttatagcaac
ttaagtcgtgaccatctggattatcatggcactttagaagcttatgcagaagcgaaggcg
cgtttatttcagtttaattcgttaaaagtcgctgttattaatttagatgatgcgcatgct
gacttgatgattaagtctgcccaaaataatccagcacaacctaaaattttgacttactca
ctaactcaaaatacagctgattattacattaccgatttaagctatagcttggcgggtgca
acttttaatttagtaagtcagcaaggttcatttgcggtagaaagcccattattaggtcat
ttcaatgttgaaaatttaattgccgcactcatcgctgctgagcaagctggtttcgattta
caggcattggttaattttgttcctaaactaattggtgcgccaggccgaatgcaagttatt
cgtgatgatgagcgattatttgtagtggattatgcgcatacaccagatgcattgattcaa
gtgcttaaaacattaaagcgtcatgtttcgaatcagctttgggcggtgtttggatgtggt
ggtgaccgtgaccgtggtaagcgtccactcatgactcaagcagctttggatggcgcaaat
cctgttattctgacttcagataatccaagaacagaagaccctgaacaaatttttgctgac
atgaagcaaggaatcgatttttcagggcatcgtatgcatgaaattcatgaccgccgtgaa
gcaattaaatttgttgcagagcaagctcaagctggtgacattgtagtgattgccggcaaa
ggacatgaaaattatcaagaaattaatggtgtgcgtcactggtttgatgatgtggttgaa
gtgcgttccgcgattgatgcccaacatcatacggtagatgctgcttaccctgcacaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system