KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3714Help
Entry
ABTW07_3714       CDS       T01908                                 

Gene name
acsA
Definition
(GenBank) acyl-coenzyme A synthetases/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00010  Glycolysis / Gluconeogenesis
abd00620  Pyruvate metabolism
abd00640  Propanoate metabolism
abd00680  Methane metabolism
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
abd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABTW07_3714 (acsA)
   00620 Pyruvate metabolism
    ABTW07_3714 (acsA)
   00640 Propanoate metabolism
    ABTW07_3714 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ABTW07_3714 (acsA)
Enzymes [BR:abd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABTW07_3714 (acsA)
Lipid biosynthesis proteins [BR:abd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABTW07_3714 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADX94131
Position
complement(3968562..3970511)
Genome map
AA seq 649 aa AA seqDB search
MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVDWIKPFTQVKNTSFDK
DNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHKIVSYKELHDEVCRFAN
VLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDSQAKL
VITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNANPIEMKPGRDLWYHLIIM
EVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYVASTFKEVFDLKQDDVYW
CTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARLGHVVDKHKVSILYTAPTAIR
AMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNVVGEGRCPIVDTWWQTETGGIL
IAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAAEGNLVIKDSWPGQMRTIWGDPD
RFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHEAV
AEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKELISWVRKVLGPVASPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAVVDQLITTVYPDRQK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatctatccagtaccagaggaatttaaaaaaacagctcgtactgttgaagca
gactactttaaacgttatcaacactctatcgagaacccagatgaattctgggcagagcaa
gctaaaattgtcgattggataaagccatttacccaagttaaaaataccagttttgacaaa
gacaatttcaagattgaatggtttgctgatggtgagttgaacgtatcagcaaactgcttg
gacaggcatcttaaagaacaccctcacaaacctgcaattatttgggaaggtgatcatcct
tctcgtcataaaatcgtttcttataaagaattacacgacgaagtctgccgtttcgccaac
gttttaaagaaatatggcattggtaaaggtgaccgcgttgtgctgtatatgccaatggtg
actgaggctgcaattgccatgttagcctgtgcccgtattggtgcggtgcactgcgtggta
tttggtggtttctcaccagactcgttggcgagccgtattgaagatagccaagctaaactt
gtgattacggctgactcaagcctacgtgccggtaagttgttaccacttaaagaaaatgtt
gatttggctctagcattgccgggcacagagtgcgttgaaaacgtgattgtggtttaccgt
aatgcaaacccaatcgagatgaagccgggtcgtgatttgtggtatcaccttattattatg
gaggtggatgcaaactgtcctccagaaccaatgaaggccgaagaccctttatttattctt
tatacctctggctcgacggggaaacctaaaggagtgttacatactacaggtggttatctg
gtgtacgtagcgagtacctttaaagaagtttttgatttaaaacaagatgatgtgtactgg
tgtaccgctgatgtcggctggattacaggccatagttatctaatctatggaccattggca
aatggtacgacgaccttaatgttcgaaggtgtgcctcagtatccaacatgggcacgtctt
ggtcatgtggtcgataaacataaagtctctattttatatacagcgccaaccgcgattcgg
gccatgatgcgagaaggtgattcgtatgtacgtgaaagtaaccgtagtagtttgcgtttg
ttaggttcagtgggtgaacctattaacccagaggcttggaactggtactacaacgtagtc
ggtgaaggccgctgtccaattgttgatacatggtggcaaaccgaaacaggtggtattttg
attgcgccattaccgggggcaacagctttaaaaccaggttcggcaacacgtcctttattt
ggtattcaaccagcgattgtcgatggtgaaggcaatgaactagaaggcgctgccgaaggt
aaccttgtgattaaagattcatggccgggccagatgcgtaccatttggggtgacccagat
cgttttattgaagcttacttctcgacctttaaaaatacttattttacaggtgatggcgcc
cgccgtgatgaagatggctattactggatcacgggtcgtgttgacgatgtcttaaatgtt
tcaggccaccgtctaggtacggctgaaattgaaagtgctcttgtatcgcatgaagcggtg
gcagaagctgctgttgtgggtatgccgcatgatattaaagggcagggtatttgtactttt
gtgactttgcaggcgggggttccagagtcggaagaactgcgtaaagagttaattagctgg
gtacgtaaagtactcggaccagtagcttcaccagatgcactgcactgggcgccggcatta
cctaaaacccgttcgggtaaaatcatgcgccgtattttaagaaaaattgcagcgaatgaa
ctggatagtttgggcgatacctcaaccctagctgaaccggcagtggtggatcaactgatt
acgacagtttatcctgatagacaaaaataa

DBGET integrated database retrieval system