KEGG   Arthroderma benhamiae: ARB_00167Help
Entry
ARB_00167         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARB_00167
Transcription machinery [BR:abe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ARB_00167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 499 aa AA seqDB search
MAPVVVDRGFPNAMFISIWSTDILFNFLGAKRKASEEATTPDSKANIKKARTESPETHDQ
EETDAEKVKLVPYAEKPAVLEEREGKIEFRVVNNDSSRESFIILTGLKCIFQKQLPKMPK
DYIARLVYDRTHLSIAIVKHPLEVVGGITYRPFHGRKFAEIVFCAISSDQQVKGYGAHLM
SHLKDYVKATSDVMHFLTYADNYAIGYFKKQGFTKEISLEKSIWMGYIKDYEGGTIMQCS
MLPKIRYLEAGRMVLKQKEAVYAKIRAFSKSHIVHQPPKEWKNGVVEIDPLSIPAIKESG
WSPDMDELARQPRHGPNYNQLLHLLNDMQNHSAAWPFAQPVNRDEVPDYYEVITEPMDLS
TMEEKHEKDMYPTPQDFIKDAKLIFDNCRKYNNESTPYAKSANKLEKFMWQQIRNIPEWS
EGMIYYERQILGYLFSKYEQITPVDFLESMGSNNTPLSYLSHYHILSSIYFLSQPAVLRF
TSSMVLFFFSGLPLTGPSV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgccagtggtagttgatcgtgggtttcccaatgctatgttcatatcaatatggtcg
actgacatccttttcaatttcttaggcgcaaagcgaaaggcttcggaggaagccaccaca
ccggactccaaggcgaacatcaagaaagccaggacggaatctccagaaacacacgaccag
gaggagacagatgcagagaaagtgaagctcgttccatacgccgagaagcctgctgtttta
gaagagagagaaggaaagatcgaattccgtgtcgttaacaatgactcgtcccgggagagc
ttcatcatcctcacaggcctcaaatgcatattccagaaacaactccctaagatgcccaag
gattatatagcccggcttgtctacgaccgaacgcatttgtctattgctattgtcaagcac
ccattggaagttgttggtggaataacctaccggccattccacggacgcaagttcgctgag
attgtgttctgtgctatttcgtcagaccagcaggttaaggggtatggagcacacctcatg
tctcatctgaaagattatgttaaggcgacctcagacgtaatgcacttcctaacctatgcg
gataactatgcaattggctacttcaagaagcagggcttcaccaaagagatcagccttgaa
aagtccatatggatgggatatataaaggattacgaaggaggtaccattatgcagtgctct
atgcttcctaagatacgctatctagaagccggtcgtatggtgcttaagcagaaagaggcc
gtgtacgccaagatccgcgcctttagcaagtcacatattgttcaccaaccgcccaaggaa
tggaagaacggggtagtggagatcgatcctttaagcatcccggctattaaggagtctgga
tggtcaccagatatggacgagctcgcccgccagccaagacacggccctaattacaaccaa
ctcctacatctcctcaacgacatgcagaaccatagtgcagcgtggccctttgctcagcct
gtcaaccgggatgaagttccagattactatgaggtcatcacagagcccatggacctttca
acaatggaagagaagcacgaaaaggacatgtaccctactccacaagacttcatcaaggat
gcaaagctgatattcgacaactgccgcaaatacaacaacgagagcacgccctatgcgaag
agtgcgaataaactggaaaagttcatgtggcaacagatcagaaatatcccagagtggtcg
gaaggcatgatttattatgagcggcagatattgggctatcttttttctaagtacgagcaa
ataacgcccgtcgattttctcgagtccatgggctccaacaatacccccttgtcatacttg
tcacactatcacattttatcttctatatactttttgtcacagccagctgtacttaggttc
acctcatccatggttcttttctttttctctggtttgcccctgactggcccgagcgtttaa

DBGET integrated database retrieval system