KEGG   Arthroderma benhamiae: ARB_00233Help
Entry
ARB_00233         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
abe  Arthroderma benhamiae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARB_00233
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ARB_00233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 636 aa AA seqDB search
MFYTLSLLALCATTATASYGSNLNYRSPSLHHPSLGISVPKVLKRTDPAIEFAPEKLNFT
HGVASGDPYATSVILWTRCSPQFDDVNDNSTVSGDVPLYNPVPVHKDTDEHKPVSKAPIC
LEFKVSTDEKFKKVIEKGTVYTSSDVDYTVKVEATKLKPFTEYYYQFNVCDSDKKSPIGR
TKTAPAEDDLVEDISLAVYSCSNYRKFDHHYCKDFKYLTISIAFGFFNAYGNPVRKDSVD
YVLHLGGSGKDIGRVPLPDRDIFTLYDYRKRHATYRTDLDLLASHQRFPWIPVWDDHEVA
DNTYRDGSSKLNNTEESFVADGGISTDQRKMNAVRAYFEWMPIRQVEMDDNLRIWRNFQL
GSLVDVIMLDTRVYDRSITDLTWNKGYVSQLRGDASRSLMGSRQENWFYRNLIESAERGA
KWRVIGSQVVFSHINESAAFGAARNLNNDAWSGYQANRNRTFKTLYDHKIPNNIMIAGDS
HANWVSDLVWLDEVPYDPKTGEGAIGVEFAGSAISSPSPAGSKINLKNSIEKSKLLATTN
KVLQWSELYYRGYFELHFNQKEVQARFFGTPHIRDRNPDEISLANFTVKAGANRLDRGNV
GVPGGGVVENGWLKGGKVVQTNLTNNTESGMWHINK
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgttctatacactctctcttttggcgctttgcgctaccacggcaactgcatcttatgga
agcaatttgaactaccgcagtccttcgcttcatcatccctccctcggtatttctgtaccc
aaggtcctgaagagaaccgacccggctattgagttcgcacccgaaaaattgaacttcact
cacggtgtagcgtctggagacccctatgccacctccgtcatcctatggacgagatgttct
ccacaatttgacgatgtcaacgataacagcaccgtatctggtgatgtgccactttacaac
cctgttccagttcacaaagacacagatgaacataaacccgtctccaaggctcctatttgc
ttagaatttaaggtttccacggatgagaagttcaagaaggtcattgagaagggcactgtc
tataccagttctgatgtcgattatactgtcaaggttgaagccacgaaactaaagccgttc
accgaatactactaccaattcaatgtctgtgactctgacaagaagagtccaattggacgc
accaagactgcgccagctgaggatgacctggtggaggatatctccctcgccgtctactct
tgtagcaactaccgtaagtttgaccaccattactgtaaagatttcaaatatttaactatt
tcaatagcctttggcttcttcaacgcctacggaaatccagtgcgaaaggattccgttgac
tacgtgcttcatcttggtggctctggaaaagacattggacgagttccattgcctgaccgt
gatatcttcactctatatgattaccgcaagcgtcatgccacctacagaactgatcttgac
ttgcttgccagtcaccaacgcttcccttggattccagtttgggatgaccatgaggtcgcc
gataacacctaccgtgatgggtcatctaagcttaacaacactgaggagtccttcgttgca
gacggtggaatcagtactgaccagagaaagatgaacgctgttcgcgcttattttgaatgg
atgcctatcagacaagtggaaatggatgacaacctccgtatttggcgcaacttccagctc
ggctcccttgttgatgttatcatgcttgacacccgtgtgtatgatcgatctattaccgac
ctaacgtggaataagggctacgttagccaacttcgcggtgatgctagccgcagtttgatg
ggctctcgtcaggaaaattggttctaccgcaacctcatcgagtctgccgagcgaggtgct
aagtggcgtgtcatcggcagccaggtcgtgttctcccacattaacgagtctgctgccttt
ggtgctgcccgtaacctcaacaatgatgcctggagcggttatcaagcaaatagaaaccgc
acgttcaagaccctctacgatcacaaaattccaaacaacatcatgattgcaggcgacagc
catgccaactgggtcagtgatcttgtctggcttgatgaggtcccatatgatccaaagacc
ggcgagggtgccattggtgtcgagtttgccgggtctgccatctcttcaccatctcctgct
ggcagtaaaataaaccttaagaactcgattgagaagtccaagctactcgcaaccaccaac
aaggtcctgcagtggtccgaactgtactaccgtggctacttcgagctgcacttcaaccag
aaggaagtccaggctcggttctttggaactccccatatccgtgaccgaaacccagatgag
atctctctggccaacttcactgtcaaggcgggagccaaccgccttgaccgcggcaacgta
ggtgttcctggcggtggcgtggtagagaacggatggctcaagggtggaaaagttgttcag
accaacttgaccaacaacaccgagagcggaatgtggcacatcaacaagtaa

DBGET integrated database retrieval system