KEGG   Arthroderma benhamiae: ARB_00255Help
Entry
ARB_00255         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abe  Arthroderma benhamiae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARB_00255
   00052 Galactose metabolism
    ARB_00255
   00500 Starch and sucrose metabolism
    ARB_00255
   00520 Amino sugar and nucleotide sugar metabolism
    ARB_00255
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ARB_00255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MRNALNALSDTVKDPAEKKRFEAEMDNFFSLFRRYLNDKAKGNVLSWDRIAPPQPNQVVE
YDDLGESASVEYLKKLAVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEYLNRT
YNVSVPLVLMNSFNTDDDTQSIIKKYEGHNIDIITFNQSRYPRILRDSLLPAPKSYNSAI
SDWYPPGHGDVFESLMNSGTLDKLLDRGVEIIFLSNADNLGAVVDMRILEHMVKNDAEYI
MELTNKTKADVKGGTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNLRAV
KRVVEEGGLQMEIIPNGKTIPADKKGEADISIIQLETAVGAAIRHFKNAHGVNVPRRRFL
PVKTCSDLMLVKSDLYTLKHGQLVIDPNRFGDAPLIKLGTDFKKVSDFMNHIPSIPRILE
LDHLTISGAVNLGRGVTLKGTVIIVATEGSTIDIPPGSILENVVVQGSLRILEH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgccctcaacgcccttagcgacaccgtcaaggatcccgccgaaaagaagcgg
ttcgaggccgagatggacaacttcttctcgctcttccgcagatacctgaacgacaaggcc
aagggcaacgtcctctcctgggaccgcattgctcctccacagcccaaccaggtggtcgag
tacgacgacctgggcgagtccgcctcggtcgagtatctcaagaagctcgcagtcgtcaag
ctcaatggcggcctgggtacctccatgggatgcgtgggaccaaagtccgtcatcgaggtc
cgcgagggcatgtccttcctcgacctctccgtcagacagatcgagtacctcaaccgcacc
tacaacgtcagcgtgcccctggtgctcatgaactccttcaacaccgacgatgacacccag
tccatcatcaaaaagtacgagggccacaacatcgacatcatcaccttcaaccagtccaga
tatccccgtatcctcagggactcccttcttccagcgcccaagagctacaactccgccatc
agtgactggtaccccccgggccacggagacgtcttcgagtctctcatgaactcgggcacc
ctcgacaagctgctcgaccgcggtgtcgagatcatcttcctctccaacgccgacaacttg
ggtgctgtcgtcgacatgcgcatcctcgagcacatggtcaagaacgacgccgagtacatc
atggaactcaccaacaagaccaaggccgacgtcaagggtggtaccatcatcgactacgag
ggtaaagcccgcctgcttgaaatcgcccaggtgcccaaggagcacgtcaacgagttcaag
tccatcaagaagttcaagtacttcaacaccaacaacatctggatgaacctccgcgccgtc
aagcgtgtcgtcgaagagggcggcctccagatggagatcatccccaatggcaagaccatc
cccgccgacaagaagggcgaggcagacatctccatcatccagctcgagactgccgtcggt
gctgccatccgccacttcaagaacgctcacggagtcaacgtgccccgtcgccgcttcttg
cccgtcaagacctgctccgacctcatgctcgtcaagtctgacctctacaccctcaagcac
ggccagctcgtcatcgaccccaaccgcttcggtgacgcccccctgatcaagctcggaaca
gacttcaagaaggtctccgacttcatgaaccacatccccagcatccctcgtatcctcgag
ctcgaccacctcaccatctccggtgccgtcaacctcggccgtggtgtcaccctcaaggga
accgtcatcatcgtggccaccgagggcagcaccattgacatccccccaggctccatcctt
gagaacgtcgtcgtccagggcagtcttcgcatcctcgagcattag

DBGET integrated database retrieval system