KEGG   Arthroderma benhamiae: ARB_00263Help
Entry
ARB_00263         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ARB_00263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MGRSAIVQEYGPPPLANTTITFDRKTTDEVAHDIIKRPKGYRVSWHSNATVEPHHFGQSH
PMKPWRLTLTKQLVMAYGMHHAMDLYVARAATYDEMAEFHSTDYLDFLSQVIPADMDSAA
QQDRLAGFNFGDDCPIFDGLYDYCALYSGGTVDAARKLCNNQSEIAINWSGGLHHAKKTE
ASGFCYINDIVLGILQLLRHHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKDNF
FPGTGPLDSTGPTHPLNPGAHHSLNVPLNDGIEDNDYVNLFKAIIGPCITTYQPTAIVLQ
CGADSLGCDRLGCFNLNIRAHGACVAFTKSFGLPTLVLGGGGYTPRNVSRLWAYETAICV
GAEDQLDPKLPETLPFRSHFQPDCSLFPPLSDLRKVENKNTKQYLDSLVEGILEQLRYIN
GAPSVQMSVIPPDILGIREEIEKEIEEENQLNEDENEDRGVNGTSSRRKDAERGTATAGE
LYT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggccgatccgccattgtccaagaatacggccctccacccctcgccaacacaaccatc
acatttgaccgcaagaccactgatgaggtggctcacgacatcattaagaggccgaagggg
tacagagtgtcatggcactcaaatgcaaccgttgaaccacaccattttggccagtcgcac
cccatgaagccatggcgcctgacgctcaccaagcagcttgtcatggcctatgggatgcac
cacgccatggatctttatgttgcccgagcagcaacttacgatgaaatggcggaattccac
agcacagattaccttgactttctgagccaggttattcccgccgatatggacagcgcagcg
caacaggatcggctagccgggttcaactttggcgatgactgtcccattttcgacggcctc
tatgattactgcgctctttattccggtggaaccgtcgatgctgctcgaaaactatgcaat
aatcagtccgagattgccattaattggtccggtggattgcatcatgcgaaaaagacagag
gcaagcgggttctgttacatcaatgatattgtactcggaatccttcaactgctaaggcac
catcccagagtgatgtatattgacatcgatgtccaccatggagacggagttgagcaggct
ttttggtcaacagaccgagttcttaccgtttctttccacaaatatgacaaggataatttc
tttccgggaactggcccgctcgatagcactgggccaacacatcccctaaaccctggggct
caccattctttaaacgtcccattaaacgacggaatcgaagacaatgattacgtcaacctt
tttaaagccattatcggcccatgcattaccacctaccaacctactgcgatagtcctacaa
tgtggtgctgatagcttgggttgtgacagactgggctgttttaacctcaatattcgcgca
cacggagcatgtgttgcctttacaaaatcgtttggcctacctactctcgttcttggtggt
ggagggtatactcctcgcaatgtctctcgtctgtgggcttacgagacagctatatgtgtt
ggagccgaagatcagctcgaccccaaacttcccgaaacacttccctttcgcagccatttc
cagcctgactgctcactcttcccgccgctatcagatctacggaaagttgagaacaagaat
accaagcagtatctagattctcttgttgaagggatattggagcagctgcgatacattaat
ggtgcaccaagcgttcagatgagtgtgattccgccagatatattaggaattcgagaggaa
atcgagaaggaaatcgaggaagaaaaccagctgaatgaagatgaaaacgaggaccgagga
gtaaacgggacatcgagccggcgaaaggacgcagagcgagggactgcgactgctggtgaa
ctttatacctga

DBGET integrated database retrieval system