KEGG   Arthroderma benhamiae: ARB_00370Help
Entry
ARB_00370         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
abe  Arthroderma benhamiae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MASAARTFSRALARGATPVTSVRPSATRNAARFSLPAQTYRASWRRGYSTASEPQKSSSG
MYWALGAVALAAGGTYYYMNNESFAAAQKPFVPTKEDYQKVYDEIAHLLVEKDDYDDGSY
GPVLVRLAWHASGTYCKDTKTGGSNGATMRFDPESNHGANAGLKTARDFLEPVKAKFPWI
SYSDLWTLAGACAIQELQGPTIPWRPGRKDNDASACTPDGRLPDASKDQKHIRDIFGRMG
FDDREMVALCGAHALGRAHADRSGYDGPWDFSPTVMTNEFFKLLLSEKWVNKKWSGPAQL
TDNKTKTLMMLPTDMALIKDREFKKHVERYAKDSDVFFKEFSEAFVKLLELGVPFESKPE
DRFVFKPSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctgcccgtaccttctcgagagctcttgctcgcggcgctacgcctgtgacc
tccgtcagaccctcggcaactcgtaatgctgctcgattttcccttccagcacagacctac
agagcctcctggcgaagaggatactccacggcctctgagcctcaaaagtcctcctctggc
atgtactgggctctcggagccgttgccctggctgccggtggtacttactactacatgaac
aacgagagctttgctgctgctcagaagccatttgtcccaaccaaggaggactaccagaag
gtttacgacgagattgcgcaccttcttgtggagaaggatgactatgatgatggcagctac
ggaccggttctcgttcgtctcgcctggcacgcatccggcacatactgcaaggacaccaag
accggaggaagcaatggagctaccatgagattcgaccccgagtctaaccacggagccaat
gctggtctcaagactgctcgcgactttttggagcccgttaaggccaaattcccatggatc
tcctactctgatctctggactcttgccggtgcctgtgccatccaggagttgcagggtccc
accatcccatggagacctggccgtaaggacaacgatgcctctgcttgcactccagatggc
cgcctccccgacgcctccaaggaccagaagcatatcagagacatctttggccgcatgggc
tttgatgaccgtgaaatggttgccctctgcggtgctcatgccctgggtcgtgcccatgct
gaccgttccggatatgacggtccttgggacttcagccctactgtcatgaccaacgagttc
ttcaagctcctcctctctgagaagtgggttaacaagaagtggtccggccctgcccagctc
actgacaacaagaccaagactctcatgatgcttcccactgatatggccctgatcaaggac
cgtgagttcaagaagcacgtcgagcgctacgccaaggactcggatgttttcttcaaggaa
ttctccgaggctttcgtcaagctccttgagcttggtgttccattcgagtctaagccagag
gaccgcttcgttttcaagccctccgagtaa

DBGET integrated database retrieval system