KEGG   Arthroderma benhamiae: ARB_00372Help
Entry
ARB_00372         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abe  Arthroderma benhamiae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARB_00372
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ARB_00372
Exosome [BR:abe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARB_00372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MAEEKSTKNSLAALRESAIEVVKGLADTFEDGLDTFAVRNAILPSREERPSRFIGAIDQG
TTSTRFIIFDLQGSIAASHQTELGRVHDQPGWHEQDPAEIISSAQKCIEQATKTFINNGH
DISEIEVLGVTNQRETTVVWDWETGKPLYNAIAWPDTRTKSIVREFKEKGADQLQEICGL
PISTYSSSAKLVWLLRNVPEVKTAYDAGNLAFGTVDTWLLYNLNGGKEKNVFVTDVSNAS
RTMFTNLHTLKYDDKLLNFFGLDRSKLRLPKIVPSADPTAFGQLATGVLKGVRIMSCLGD
QSAALVGHEAFEPGMAKNTYGTGCFLLYNVGEKPVISSHGLLATVGYQLGANSKPVYALE
GSIAVAGSGVNFLMNNLGFFRDARRVDDEASSVQDNGGCVFVTAFSGLFAPYWIDTAKGT
IFGITQHTKKGHIARATLEAVCFQTKAVLDAMERDSGQKLAELRVDGGLSTSNVCMQLQS
QADIIRIPVKRPAMHEVTALGAAIAAGIAIKIWEGPRNLDGLKQSDKTVFEPKLPEEESN
RIYKKWSKAVEMSRGWMDSSD
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagaagtcaaccaagaactcgcttgctgctcttcgagagagcgccatagag
gtcgtcaagggactagcagatacctttgaagacggactagacacttttgccgttcgcaat
gcgatcctccccagccgggaggagcggccgtccaggtttataggagctattgaccagggc
actaccagtactcggttcatcatatttgacctgcagggaagcattgctgcctcccatcag
acagagcttggacgggtacatgaccagcctgggtggcatgaacaagatccagcagagatc
atttcctcggcacaaaagtgcattgagcaggcaacgaagacgtttatcaataatggtcac
gatatcagtgagattgaagtactcggagttactaatcaacgagaaaccactgtcgtttgg
gactgggagaccggtaagccgctatacaacgctatagcctggccagatactcgtaccaag
tccatagtcagagagttcaaggagaaaggggccgatcagctgcaggaaatatgtggtctg
cccatatcaacatactcttcgtctgccaagttggtctggttactccgcaatgtaccagag
gtgaagacggcttatgatgctggtaacctggcattcggtactgtcgacacttggctgttg
tataatctcaatggtggcaaggagaaaaatgtattcgtaaccgatgtatcgaatgcttca
cggaccatgttcactaacctacataccctcaaatacgacgacaagctactcaactttttc
ggcctagatcggtcaaaattgagactaccaaaaatagttccatctgcagatcccacggcg
ttcggacagctggccaccggagttctcaaaggtgttcgaatcatgagttgtcttggtgac
cagtctgctgcattggtaggtcatgaagcattcgagcctggcatggctaaaaatacttac
ggaaccggttgctttttgctttacaacgtcggtgaaaagccagttatctcctctcatggg
cttctcgcaaccgtgggatatcagttgggcgcgaactcaaagccggtatatgccttggaa
ggtagcatagccgttgccgggagcggcgtcaactttcttatgaataacttgggcttcttc
cgagatgccaggagggtcgatgacgaggcttcgagtgtacaagataatggtggctgcgtc
ttcgttactgcattcagcggtcttttcgctccttattggatcgataccgcaaaaggaaca
atatttggtatcacacagcatactaagaaaggtcatatcgcccgagcaactttagaagca
gtgtgttttcaaaccaaggctgtcttggatgctatggaacgtgatagcggacaaaagctt
gctgagctgagggtggacggcggcctaagtacttccaacgtctgcatgcaactgcagtca
caagccgatatcattcgcatacctgtaaaacgcccagcaatgcacgaagtaacagcgctg
ggagcggcaattgccgctgggatcgccatcaagatctgggaaggcccccgaaacctggac
ggcctcaaacaatcagacaagacggtgttcgaaccaaagctccctgaagaagaaagcaat
cgaatttataaaaagtggtccaaggctgtcgagatgtcccgaggctggatggacagcagt
gactga

DBGET integrated database retrieval system