KEGG   Arthroderma benhamiae: ARB_00407Help
Entry
ARB_00407         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
abe  Arthroderma benhamiae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:abe03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 408 aa AA seqDB search
MPELAEVARIVNYIKKHLVGHTIAKVVANHDDLLFGKVGTSADEFKKHMHGKTVIGAGQQ
GKYFWMIMSSPPHPVMHFGMTGWLKIRSENTYYRSNGKDENVEADVWPPKFWKFLLETDN
EPKTEAAFVDARRLGRVRLVDCPGDDIRKYTPLKENGPDPVIDKAILTEDWLKALVRRKK
VPIKALLLDQANISGLGNWMGYVLHLLIYFPTTKEANAGSRDEILYHARIHPEQYSDTLR
DNQIKELHSSINYVCSVSVDLKGESSDFPTDWLFHHRWNKGKKGAAGKLPSGEPIVFVTV
GGRTSAVVPSVQKKGGEDDEEETDTKPKKAAGKAKATPKVKAEEKDGADASTPATPSKKR
KQPAAKAVKEEDSAATTPALKKSRATKAKTEPEAPKVPLRRGRSATKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttgcagaagttgcacggatagtgaactatatcaaaaagcatctggtagga
cacacaattgccaaagttgtagccaaccatgacgacctcctgttcggcaaggttggcacc
agtgccgacgagttcaagaaacatatgcatgggaaaaccgtcataggagctgggcagcag
ggcaaatatttctggatgatcatgtcttcgcctccgcaccctgtcatgcattttggaatg
acgggctggctgaagataaggagtgaaaacacttactaccgcagcaacggtaaagatgag
aacgttgaggcagacgtttggcctccaaagttttggaagttcttgcttgagacggataat
gagcctaagactgaggctgcgtttgtggatgcgaggagattgggccgtgttaggctcgta
gattgccccggggatgatatacgaaagtatacacctctaaaggagaatggacctgatccg
gtcatcgacaaggccatcttgacggaagactggttgaaggctctcgtgcggcggaagaag
gtccctataaaggctctgttgttggatcaggccaatatcagcggactggggaattggatg
gggtatgtcttacatcttttaatatattttccaactacaaaagaggctaacgctggaagc
agagatgagatcttatatcatgcccggattcatcctgagcaatacagtgatacactccgg
gacaatcagatcaaggagttacactcatctatcaactacgtgtgttctgtatctgttgat
ctcaaaggagagtcttccgacttccctacggactggctattccatcatcgatggaataag
ggaaagaaaggcgcagcgggcaaacttcccagcggtgagcccattgtcttcgtcaccgtt
ggtggccgaacaagtgctgttgtcccatcggtgcagaagaagggcggcgaagatgacgag
gaagaaacagataccaagcctaagaaggctgcaggcaaggcaaaggcgactccaaaagtg
aaagccgaggagaaagatggcgccgatgcatccacaccagcaactccgagcaagaagcgt
aagcaacctgcggcaaaagctgtcaaggaagaagatagtgcggcaactacgccggcattg
aagaaatccagggctaccaaagccaaaaccgaacctgaggcgccaaaggtaccgttaaga
aggggtcgatccgcaacgaagaactaa

DBGET integrated database retrieval system