KEGG   Trichophyton benhamiae: ARB_00580Help
Entry
ARB_00580         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
Organism
abe  Trichophyton benhamiae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 547 aa AA seqDB search
MPTFGGLLKKRRTKDSKSKDLDSENSTTNTTAAAPAAAAAAATAPPAPAASVQGRHTAQS
SVDSADTSNLPPSAASKDSAAAAGAAPEPGSVPRSGSGSGTAEPVASAAPASPAPAAAGG
VTAAAIDPPSTSLTPALANMSTTYQRPSPGDVSQSRSPQQTQPSALPQPHNVTSIKNIIN
PPHHEDQQQHHNHQQQQLQQHQHATTGTPDASIRASQRQLKGKYSLSDFSIHRTLGTGSF
GRVHLVQSIHNQRFYAIKVLKKAQVVKLKQVEHTNDERAMLERVKHPFLVTLWGTFQDAK
NLYMVMDFAEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSKHIVYRDLKPENLLL
DKNGHLKITDFGFAKEVRDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLCG
FTPFWDSGSPMKIYENILKCRVKYPPSLVPDAQDLLSRLITPDLTKRLGNLHGGSQDVKN
HPWFAEVTWELLAQRRIDAPYIPPVKGGSGDACMFDTYAEETEQYGLPAEDEYVPYTLTP
RYTLAGF
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctttggaggcctcctcaagaagcggcggacgaaggactcgaaatcaaaggac
ctcgactctgagaactctactacaaacaccacggctgctgctcctgctgctgctgctgct
gctgctactgctcctcctgcgccagctgcctccgtgcaaggccgtcatacagcccagtcc
agcgtcgacagcgcagatacctcgaatctcccgccatctgccgccagtaaggactctgcc
gccgctgctggtgctgctcccgagcctggttctgttcctcgctctggttctggctctggc
actgctgagcccgtcgcctctgctgcccctgcatctcccgcgcccgctgctgctggcgga
gtgactgccgctgccattgaccctccctcgaccagtctgacgcctgcgctcgccaacatg
tcgaccacctaccagcgtcccagccccggagatgtctcgcagtcgagatctccccagcag
acacagccgtccgccctcccccagcctcacaatgtcaccagtatcaagaatatcataaat
ccgccccaccatgaggaccagcagcagcaccacaaccaccagcaacaacaactacaacag
catcaacatgctactacaggaacgcccgatgcctcaattcgagcctcgcagcgccaattg
aagggcaaatactccctcagcgacttttccatccaccgcacgctggggacgggcagtttc
ggccgagttcatctcgttcaatctatacacaaccagcgattctacgctatcaaagtcctc
aagaaggcccaggttgtcaagctcaagcaggtcgagcatacaaacgatgagcgggcgatg
ctcgagcgggtcaagcacccgtttcttgttactctatggggcacctttcaggacgcaaag
aatctctacatggtcatggatttcgcagagggtggtgagctcttcagtctcctcagaaag
tcccagcggtttcccaacccggtggcgaaattctacgccgccgaagttacacttgccctg
gagtacctgcactccaaacacatagtataccgagacctgaagcccgagaacctgcttttg
gataagaacgggcatctcaagatcaccgattttggcttcgcaaaggaggtacgggatatt
acgtggacgctatgcggcacgccggactacctcgcccctgaggtggtttcctccaagggc
tacaacaaatctgtcgactggtggtcgctaggtatactcatcttcgaaatgctctgtggt
ttcaccccattctgggacagtggctcgcccatgaagatatacgagaacatcctaaaatgc
cgcgttaaatacccgccgtccctggttccggatgcgcaggatctactatcgcgactaatc
acacccgacctgaccaagagactgggtaatttacacggtggatctcaggatgtcaagaac
catccatggtttgcggaggtcacctgggaactgcttgctcagcgacggatagacgctccg
tacatacctccggtcaagggcgggtcgggcgatgcatgcatgttcgacacctatgcggaa
gagacggaacagtatggtcttcctgctgaagatgagtacgtaccttataccctcacaccc
agatacacccttgccggcttctag

DBGET integrated database retrieval system