KEGG   Arthroderma benhamiae: ARB_00604Help
Entry
ARB_00604         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARB_00604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MVQPGDDGQKLTTLSTFNPQFTYPLFGDEESIFGYKKLNIKLRFAAHDLQSHVQISYNEK
FKQVEDIKAADLLGILKPCLPEVSFSTIDEFKKRINEGDAASFTPPGKLVHSYSRDDKDY
EIWAGSLADPEVRKTLDRIQIFVSFFIEGGTPIETDDFDWTLERWIIYFVYEKQKEPSSP
KASRYSFAGYATTYRWYFFHPQSSNAAKLAYEAQKTEAFDSFPVSKIPARLRIAQFLIIK
PHQHAGHGSQLYRTIQKACLEDPTIFELTIEDPNESFDALRDSNDYHTLKPEFSKHNITI
NANPIPNTTPGSSSSQPPKHPRVMPTSLLIPTKTLDDLRQEFKIAPTQFAHLVEMYLLSQ
IPQSHRGAENVNMTRLTTQKSRLQNEHDRRYYWWRMLVKQRLYKRHRDMLIQIDKDERVV
KLDETLQNVEEGYDVLLKAFDERASKVSGNGKGKDREADDNEDGNEASASATKMRSKRKF
TVEDDDDEMEDAPSAKNRGGKKPKV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggtccagccaggtgatgacggccagaagctgaccaccctctcaaccttcaacccccag
ttcacatatccacttttcggagatgaggaatcgatctttggctataaaaagctgaatatc
aagcttcgatttgcggcgcatgacctccaatcacacgttcagatctcgtacaatgagaag
ttcaagcaggtagaggatataaaagctgctgacctccttgggatcctcaaaccgtgtctt
ccagaggtttcattttcgaccatcgatgagtttaagaagcgtataaacgagggggatgcg
gcgagctttacacccccaggcaagctcgttcatagctattcgagagatgataaagactat
gagatatgggcgggctccctggccgatccagaagtacgcaagactctggataggatacag
atcttcgtgtcgttcttcatcgaaggtggaacccccattgaaacagacgactttgactgg
actctggaaagatggataatatattttgtatacgaaaagcaaaaagagccatctagccca
aaagcatcaaggtactcctttgcaggatacgcaaccacatacagatggtactttttccat
cctcaatcatcgaatgctgcaaagttggcatacgaggcccagaaaacggaggctttcgat
tcattcccagtctcaaagatacccgcgcgtttacgcattgctcagttcctcattattaaa
ccacatcagcacgctggtcatggatcccagctctatcgcacaattcaaaaagcctgcctt
gaggaccctaccatcttcgaacttaccatcgaggatccaaacgagtcatttgatgcactt
cgagactcaaacgactaccacacgttaaaaccagaattctctaaacataatattacaatc
aacgccaaccccatcccaaacactacccctggaagctcctcttctcaacctccaaaacat
ccccgcgtcatgccaacctctctgctaatccctacaaaaacccttgatgatctcaggcaa
gagttcaaaatcgcccctactcaattcgcccatctggttgagatgtatcttcttagccag
atacctcagtcccaccgtggggcggaaaacgtcaacatgactcgtcttacaacgcagaag
tctcgactgcagaatgagcatgatagacggtattattggtggcgcatgcttgttaagcag
cgattgtacaaacgacaccgtgatatgttaatacagattgataaggatgaacgggtagtc
aaacttgacgagacgctgcagaacgtggaagaagggtatgatgttctgctgaaggcgttt
gatgagcgggcttcaaaggtatcaggcaatgggaagggtaaggaccgagaagccgatgat
aacgaggatgggaatgaggcttccgcctctgcgactaaaatgcgctcaaagaggaagttc
actgttgaagatgacgatgatgagatggaagatgccccgtcggcgaagaatagaggtggg
aagaagccaaaggtctaa

DBGET integrated database retrieval system