KEGG   Arthroderma benhamiae: ARB_00632Help
Entry
ARB_00632         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     ARB_00632
Protein kinases [BR:abe01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   ARB_00632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MAWRASERLMETIRHYASFPATGVSLRQMVQFGDKPSTGDLPDGLNEMPSIKKVQDWYAQ
SFEEITKLERPKLTEEVRSRLLNSSRMNGREPRMLEQATPNPSIKQGQYRSSPTTSILNS
IYSNGNSSVIGNNGSTTTTTTATNGAKHRVAGTRRYFVAADDGADWPPELIDYNARLAST
LDTIKRRHDSVVTTVAQGVLEWKRKKQRLQIDSGIQAFLDRFYMSRIGIRMLIGQHIALT
NQHHTFHPNYVGIICTKTNVRQLAQEAIDNARFVCEDHYGLFEAPKVQLVCRDDLDFMYV
PGHLSHMLFETIKNSLRAVVETHGPENDSFPVTKVIVAEGREDITIKISDEGGGIPRSAI
PLVWTYMYTTVDQTPNLDPDFNKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGPD
IPTLHANHSCKHSSKPILIDANNK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggagggcttcggagcgtctcatggagaccatccggcactatgcctcgttcccg
gcaacaggagtgtcgctgcgacagatggtgcagtttggcgacaagccgtcgacaggagac
ctaccggatgggttgaatgagatgccgtctatcaagaaagtccaggactggtacgctcag
tcgttcgaggagatcaccaagttggaacggccaaagttgacagaagaagtacggtcacgg
ctgctcaattccagcaggatgaacggccgcgagccacgcatgctggagcaagcaaccccc
aaccccagcataaagcagggccagtaccgctcctcgccaacgacatccatcctcaacagc
atctacagcaacggtaactccagcgtaatcggcaacaatggcagcacaacgacgacaacc
acggcgactaatggcgcgaaacaccgggttgcagggactcgccggtactttgttgctgcg
gacgacggcgccgattggccgccggaattgatcgactacaacgctcgtttggcttcgacc
ctggacacaatcaagagacgacacgacagcgttgtgacgacggtggcacagggcgtgctg
gagtggaagcgcaagaagcagcggctgcagatcgactctggaatacaagccttcttggac
cggttttacatgtcccgtattggcattcgtatgcttattgggcagcacattgctcttacc
aaccagcaccacacattccatccaaactacgtcggaattatctgcacaaagacaaacgtc
cgtcagttggcgcaggaagccattgacaacgcccgctttgtctgcgaagaccactatggc
ctctttgaagctcccaaggtccagctcgtttgccgcgatgatctcgatttcatgtacgtg
cccggccacctgtcacacatgctcttcgagacgatcaagaactcgctgcgtgcggtggta
gagacgcatggaccagagaatgattcgttccccgtaaccaaagtcatcgtggccgaggga
agggaggacattaccatcaagatctctgatgaaggtggcggtattcctcgatcagccatc
ccgcttgtatggacgtacatgtacaccaccgttgaccagacgcccaatctcgacccagac
ttcaacaagagcgacttcaaggcccccatggccggattcggatacggtctacccatcagt
cgactctacgcccggtactttggcggtgatctcaaactcatcagcatggaaggtccagac
atcccgacacttcacgccaaccactcttgcaaacactcttccaagcccatcctcattgac
gccaacaacaaatga

DBGET integrated database retrieval system