KEGG   Arthroderma benhamiae: ARB_00670Help
Entry
ARB_00670         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abe  Arthroderma benhamiae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_00670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_00670
   00020 Citrate cycle (TCA cycle)
    ARB_00670
   00620 Pyruvate metabolism
    ARB_00670
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ARB_00670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MASAAVLSRRLLLSKTAQHGLRESRNVLRLSDALSDIAYPPHTIISMPALSPTMTSGNIG
AWNKKAGDTLSPGDVLVEIETDKAQMDFEFQEEGVLAKILKDAGEKDVAVGNPIAVMVEE
GEDISPFESFSLEDAGGDKAPAADKSPKEAPKPEEAETKAAPTPTFEENKPEAQEADTTG
EKLQPSLDREPFVSPAAKALALEKGVAIKDVKGTGPGGRVTKEDVEKHQASAPATGAAGP
AYEDVPASSMRKVIASRLAQSIRENPHYFVSSTLSVTRLLKLRQALNESSEGRYKLSVND
FLIKACAVALKRVPTVNSRWIEQNGQVMIREHKTVDISVAVATPSGLITPIVKGVEGLGL
SNISSQVKDLGKRAKENKLKPEEYNGGTFTISNMGMNPAIERFTAVINPPQSAILAVGTT
RKVAVRSELEEGTEIEWDDQIVVTGSFDHKVIDGAVGAEFMRELKRVVENPLELLL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctgccgtgctgtcgcggcggttgctgctctccaagaccgcacaacatgga
ctgagggagtcgcggaatgtgcttcgtctttctgatgcgctcagtgatatagcttaccct
ccccacaccatcattagcatgcctgctctctcgcctactatgacttctggaaatattgga
gcttggaacaaaaaagctggagatactctctctcccggcgatgttttggtagaaatcgaa
accgacaaggcccagatggactttgaattccaggaggaaggtgttttggctaagatcttg
aaggatgctggtgagaaggatgtcgctgttggtaacccaattgccgtcatggttgaagaa
ggagaggacatcagcccattcgagtctttcagtttggaggatgcgggcggtgacaaagct
cctgctgctgacaagtcacccaaggaggccccgaagcccgaggaggctgagaccaaggcc
gctccaaccccaaccttcgaggagaacaagccagaggcccaggaagcagacactaccgga
gagaaattgcagcccagtcttgacagagagccatttgtcagcccggctgctaaggcgctc
gctcttgagaagggtgttgcaatcaaggacgtcaagggaacgggcccaggtggacgagtc
accaaggaagatgttgaaaagcaccaggcttctgctccagctactggtgccgctggccca
gcctatgaggacgttccagcctcctccatgcgcaaggttatcgccagccgtcttgctcag
tcgatccgcgagaacccacactacttcgtttcctccactctgtctgtcacccgtcttctc
aagcttcgccaagcattgaacgaatcctcagagggtcgatacaagctttctgtcaatgac
ttccttatcaaggcctgcgctgttgcactcaagagagttcccactgttaactcccgatgg
atcgagcaaaacggccaagtgatgattcgtgagcacaagaccgtcgacatcagcgttgcg
gttgctactccatctggccttattactcctattgtcaagggtgtcgagggacttggcctg
tccaacatctccagccaagtcaaggacctcggcaagcgcgcaaaggagaacaagctcaag
cctgaggagtacaacggcggtactttcaccatcagcaacatgggcatgaaccctgccatt
gaacgtttcactgccgttatcaaccctcctcagtccgctatccttgcggtcggtaccact
cgcaaggtagctgtccgctccgagcttgaggaaggcactgaaattgaatgggatgaccag
attgtggtcaccggcagctttgaccacaaggtcattgacggtgctgtcggagctgagttc
atgcgtgagctcaagagagttgtcgagaaccctctcgaacttctcctctaa

DBGET integrated database retrieval system