KEGG   Arthroderma benhamiae: ARB_00683Help
Entry
ARB_00683         CDS       T01611                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARB_00683
Peptidases [BR:abe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARB_00683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1700 aa AA seqDB search
MHTQGKEEKKQKKNTSPIPELPLVSGQLTFTTPSSKRRKVAAELRKAGGNKGLYFLKTSP
PRKPKIGKRYGQSSSTSALSALPQRGFFTEPSSPSSPRLSPARSLQVDSSHGSANEQSST
EDWRSTTATSSPTVTDGESTQDTTCWPMSSSNNNNRAAGQSAAAASDPPKEDVSMVDSNS
SSVGGSLDNGNSHTAPPAIKRPAAEMGCDEHDTVMQTDSPSLGSQEEAEKSSNKAAGSKK
QAERLNRHQRDASVDMVGKETESETSKGGRKHASETSSSGTDPTIYTPSSSSGQTHASHD
DNPSIDEQVAQVMQLMQQSPTDKQKGYIVSATWLKRVLSRSSTHPRPDKADKLAAEGEIG
PVDNSDLVLVTDPDTIFNDEAGEPFVPMRPGLQMGEDYEILPEEAWNLVMKWYGLSNQSP
AIVRYAHNTNTEGDMEHIQYELNPPIFSILKLSPNPSEAEKSKPPVRFLASRHTPFQQWL
KTAKTLASINMSTKTRVWRILEGLGSSANVTPAASRSASPAPGTTVSTKIPTSISLGLEA
FVGLTEGSQRELVDVQDHTANTKYNGRASIHVIGLGSDNVIVLEEQVGGPAGGEWLSETT
KSSTNLTVGAGTKANVQNRLKNKSSSGSGRTSPAPSIVTRGRRRKDGKARGVTGLSNLGN
TCYMNSALQCVRSVEELSHYFLMGEYKKDLNPNNPLSHNGDVAKAYANLLHQIFDVQGSA
SFAPRNFKVTIGRYGPSFSGYGQQDSQEFLLFLLDGLQEDLNRIQKKPYIEKPDSTDEMV
HDKVALQRFADRCWEIYKARNDSVITDLFSGMYKSTVVCPECDKVSIIFDPFNNLTLQIP
IENSWSHKIMFFPLHKPPVNIDVDIDKNSGIKAVKQFIAKKMNVNADRLVMAEIYKHKFY
KLFDHSQSIADHQISEGDTIAMYELDSVPTSYNPEKPRRFRFSSEEPAVGFNSPKADRML
VPIYNRGRVRRGYGQMQRGLFGVPMYVVISREEAYDYDAVLRRILARVANLTTRDILRED
DGLGVTRAQQQAGEDSDTVVMNEDDTQAYGQTIKASSVEGEDGLVDVSMRDADQDEATAA
RCNNNNNDNSDNKGGDDEELAPVLRPGSFIPPMLRNLFDVRYIATNDSEPTGFSIINEAR
EYPLMLSRVPDGKSSSSSGSSSNNGGGGGASKMVFGRRADAESVASSDDELSGPAQPVNV
MRTRAAAAADDEMSTNSSSAETKDDSGSETDSDRMAGATSLLRSGKARSSSSKQKPAKKP
VQRRLPYVKPGDVIVLDWNEETYDGVFGDEDELYGDNDEGGDGGLRGRPTWTNVSDVVDP
EVTSKRQLRSRKKRRGITLDECLDEFGREEILSENDAWYCPRCKEHRRASKKFELWKAPD
ILVMHLKRFSANRIFRDKIDAVVDFPLELDMSGRVQMVEEGESMVYDLIAVDNHYGGLGG
GHYTAYARNFVDGLWYEFNEQAHDRASDDSGSESGSGNGTSGTGGGSGGGGSGGGGSGSG
EGKRLGGLSRNGSSGALHGAAATRQSGDGGLPTDEEEEVDVEGSGEVGEAGPDDEDEEEE
GDEGFSSVRFHAGSAMYAQQPSWSYDRLANHGYGEDEIPRVFPPPGSSYADDGEGDDVAS
TQAERGEGDLSELDRSFELDAEGDADADETGMVFSSVLDEEHAHGHGHGLGHGLGHGSSP
AMQNEFDDCPAVVEVRVDEE
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atgcacacacaagggaaagaagaaaagaaacaaaaaaaaaatacttcaccgattccagag
ctgccactggttagtgggcagctcaccttcaccacgccttcatcaaagcgacgcaaggtt
gccgcagagcttcgcaaagctggaggcaacaagggcttatacttcctcaaaacctcccct
ccccggaaaccaaagataggaaaacggtacggccagtcttcgtctacgtctgccctgtct
gcactgccgcagcgtggcttcttcaccgagccgtcctcgccctcctcgccgagactgtcg
cccgcccggtccctgcaggtagactcctcgcacggaagcgcaaacgaacagtcgtccacc
gaagactggagatcgaccactgcaacgagctctccgaccgttacggacggcgagtcgacc
caagacactacctgttggcccatgtcatcgtctaataacaacaaccgagcggccggccag
tccgccgctgccgccagtgatcccccgaaggaggatgtttccatggtagacagcaacagc
agcagtgttggtggttctctagacaacggcaactctcacactgctccaccggccatcaag
agaccggctgccgagatgggctgtgacgaacacgataccgtgatgcagactgattcccct
tcgttaggctctcaggaagaggccgaaaagagcagtaacaaggcagcaggaagcaagaag
caggccgagcgtctgaatcggcaccagcgtgatgcctccgttgacatggttggaaaggag
actgagtccgagacatccaagggaggccgaaagcacgcttccgaaaccagcagttctgga
actgatccgaccatctacaccccgtcatccagcagcgggcaaacccatgcttcccacgac
gataacccctctatcgacgagcaagtcgcccaggtcatgcagttgatgcagcagagcccc
accgacaagcaaaagggctacattgtttctgctacctggctgaagagggttctctccaga
agctctacccatccacggccagataaagcggacaagttggctgctgagggagagattgga
cccgttgacaactcagaccttgtcctcgttactgatccggacaccatcttcaacgatgaa
gcgggcgagccattcgtccccatgcgtccgggcctgcagatgggcgaggactacgagatc
ttgccagaggaagcttggaacctggtgatgaaatggtacggcctatcgaaccagtccccc
gccatcgttcgatacgcacacaacaccaacaccgagggagacatggagcacatccagtac
gagctcaatcctcccattttctccatcttgaaactgtctccaaacccgtccgaggcagag
aagtccaaacctcccgtcagattcttggccagcagacatacccctttccagcaatggctc
aagaccgcaaagaccctggcatccatcaatatgtccaccaagactcgggtctggagaatc
ctagaaggactcggtagttccgccaacgtaactccggctgcgtcaagaagtgcgtcccca
gcaccgggaactaccgtctcgacaaagattcccacctccatctccctgggcctggaagcg
ttcgtgggtctgactgagggatcccagcgagagcttgtggatgtccaagaccatactgca
aatacaaagtacaacggcagagcgtctattcatgttatcggtctaggaagcgacaacgtt
atcgtcctggaggagcaagttggcggtccagcaggcggagaatggctgtccgaaacaact
aagtcgagcaccaacctgaccgtcggagctggcaccaaagccaatgtccaaaacaggctg
aaaaacaaaagctcctcgggcagcggacggacatcgcctgctccttcaatcgtcacccga
ggacgacggcgcaaggacggcaaagctcgaggagtgaccggactaagcaacctgggcaat
acatgctacatgaactcggcgcttcagtgtgtccgcagtgtcgaggagctgtctcattac
tttttgatgggcgagtataagaaggacctgaacccgaacaaccccttgtctcacaacggg
gatgtcgccaaggcgtatgcaaatctgctgcatcagatatttgacgttcagggatcggct
tcgtttgctccccggaacttcaaggttaccattggcagatacggcccttcgttctctggc
tatggacagcaggactcccaggaattcctgctcttcctcctggacgggctgcaggaggat
ttgaaccgtatccaaaagaaaccatacattgagaagcctgattccaccgacgagatggtc
catgataaagtggcactccagcgctttgcggaccgctgttgggagatctacaaggccagg
aatgacagtgtgattactgatctgttttcggggatgtacaagtccactgtggtgtgtcca
gagtgcgacaaggtcagcatcatctttgacccgttcaacaacctgacgctgcagattccg
attgagaatagctggagccacaagatcatgttcttcccgctgcacaagccaccggtgaac
atcgacgtggacattgacaagaactcgggcatcaaggcggtaaagcagttcattgcaaag
aagatgaacgtgaacgctgacaggctggtgatggccgagatctacaagcacaagttctac
aagctgtttgaccacagccagagcatcgccgaccaccagatcagcgaaggggacactatt
gccatgtacgaacttgacagtgtgccgacaagttacaacccggagaagccacggcgcttc
cgcttctcgtctgaggagcctgcagtcgggttcaactcgcccaaggcagaccggatgctg
gtaccaatctacaatcgcggccgggtgcgtcgcgggtacggccagatgcagcgggggtta
tttggcgtgccgatgtacgttgtgatttcacgtgaggaagcgtatgactacgatgcggtg
ctgcgacggatcctcgcacgggtggccaacctgacgacgcgtgacattctgcgagaagat
gacgggctgggcgtgacgagggcgcagcagcaggccggggaagactctgacactgttgtg
atgaacgaggacgacacgcaggcatacgggcagacgatcaaggccagttccgtggaggga
gaagatgggctggtggatgtgtcgatgcgagatgccgatcaagacgaggctactgcagca
agatgcaacaacaataacaacgataatagtgacaacaaaggaggagatgatgaagagctt
gcacccgttctaaggcccggaagcttcatcccgccgatgctccgcaatctgtttgatgtg
cggtacattgccacgaacgacagcgagccgactggcttctcgatcatcaacgaggcccgc
gagtaccccttgatgctgtcccgcgtgcccgacgggaagagcagcagtagcagcggcagc
agcagcaacaacggtggtggcggtggagcaagcaagatggtgtttggacgacgggcagac
gcggagagcgtggccagcagcgacgatgagctaagcgggcctgcacaacccgtgaacgtg
atgcggacacgggcagcggctgcggcagacgacgagatgtcgaccaactcgagctctgcg
gagaccaaggacgacagcgggtcggagacggactctgaccggatggccggtgcaacgagc
ctgctgcggtccggcaaggcacgcagcagcagcagcaagcagaagccggccaagaagcca
gtgcagcgacggctaccgtacgtcaagccgggcgacgtgattgtgctcgactggaacgag
gagacgtacgacggggtgtttggcgacgaggacgagctgtacggcgacaacgatgaagga
ggggatggtgggctgcgcggacgaccgacgtggacgaacgtgtcggatgtggtcgacccg
gaggtgacgagcaagcggcagctgcggtcgcgcaagaagaggcgcgggatcacgctggac
gagtgcctggacgagtttgggcgggaggagatcctgtcggagaacgatgcgtggtactgt
ccgcggtgcaaggagcaccggcgggcgagcaagaagtttgagctgtggaaggcgccggac
attctggtgatgcatctgaagcggttcagcgccaaccggatcttccgggacaagattgac
gcagtggtggacttcccgctggagctggacatgagcggacgggtgcagatggtggaggaa
ggggagagcatggtgtacgacctgattgcggtggacaaccactacggcggcctgggcggc
ggccactacactgcctatgcccggaactttgtcgacggcctgtggtacgaattcaacgag
caagcgcacgaccgggccagcgacgactccggcagcgagagcggctcaggcaacggaacc
agtggaaccggcggcggcagtggtggcggcggcagtggtggcggcggcagtggatcgggg
gaaggcaagcgcctcggtgggctctcccgcaatgggtcgtcgggcgctttacacggagcc
gcagcaactcgccagtcgggagatggtggtttgccaacagatgaagaggaggaggtggac
gttgaaggcagtggagaagtgggtgaagccgggcctgatgatgaagacgaagaggaggaa
ggggacgaagggttcagcagcgtgcggttccacgccgggagcgcgatgtacgcacagcag
ccgagctggtcgtacgaccgactggccaaccacggctacggcgaggacgagataccgcgt
gtcttccctccgccggggtccagctatgcggacgatggcgagggggacgatgtggctagc
acgcaggcggagaggggggaaggcgacctgagcgagctggaccggtcgtttgagctggac
gcggagggggatgccgatgccgacgagacgggcatggtattctccagtgtcctagacgag
gaacacgcacatggtcatggacatggtcttggtcacggtcttggtcacggcagcagccct
gccatgcagaatgagtttgacgactgcccagctgtggtagaggtgcgagttgacgaggag
tag

DBGET integrated database retrieval system