KEGG   Arthroderma benhamiae: ARB_00972Help
Entry
ARB_00972         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
abe  Arthroderma benhamiae
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:abe00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1363 aa AA seqDB search
MSRASAGFADFFPTAPSVLQKKRSSKAAAGQDAGSRLRGRSAAADFFAEEHHDDEEHAAG
GGPSPSSASSSTAEQTETATPTDPYSAGSAGSAGSAAGSAAAANGGVVARVGSSSSTATE
SSSSAAATTTLNGMSACALTPLTTTDSSPPRKSGSPMLSSSRLADSEQSSISTATSASAS
ASAVEYEKYHHHHHHDQDHAKAVVASSRLPPPPRGYKLVYDPDLDKRPPASRDKRRKPQY
VAFGEGEPASDAAVAAAAEPELGQNLGPASPAVVSDPRRAIPNYTRGAASKQKTKYRPAP
YTLKPWAYDPATSIGPGPPTQIVVTGYDPLTTVAPISALFSSFGEIAEIDNRTDPTTGRF
LGVCSITYKDTRSLRGGSPLTAAQSARRAYLECKKEQRIGTRRIRVELDRNSAACNRIVA
KLIALQKQEQLAVFEQQNSDAAAAAASKKSDIPPPPPPLPLLPTGPKAETEPSSQSQSQP
KDNVPPPTAPKGPSGKSSLHPALQLQPPDGPRAAPKPPSLVEETPILDQIKRDPYIFIAH
CYVPVLSTTVPHLERRLKLYDWKSVRCDNTGYYVLFENSRRGELECERCFRGCHMTALFT
YVMNMECQQYGNPSYERSPSPERVKAEQREKSEKARLKRETELDVEEEKRLRAENVDPTT
EVVAIAIRELRDKLLEDIKTRIAAPALYDFLDPDRHRAKRQKLGIADPQGIKKPAFYLDT
GLGESATDSRNSPAPPGAQSKNVLALPRIRKARDFERNNSAFVDERRRRPTVRRREFRPL
YHRLQQLHDEDDSDDEHQTSFTRDTEDQESRPLSRLSSEADNDDDENLRGSLVPSVSGFG
DSGLDSAGIKEELDDLDRELLGEPGDYERVSKKRKRLSLELLEMEKRRKTVDELFGVDTS
HLGQEPDDDLSALVDSQAQRLGKEKGKKPKRKTKKQLLEEKKALKLAELQAAADQGLIPK
VDDLDLAVTPIEGELDIEAKEEEYEEEEEEDGYVKPEVEWGLSTTEPKPTVEDDEGIVLD
LDGWQNIVKDTEDLRFLREALESTSLQSEPNTPIITNVTAWAWNQKQIKAINSHGARGPV
HSEIKIDGYYVPNPSGSARTDGRKRILESEKSKYLPHRIKVQKAREEREALAKSDPTAAA
DAARVIAAKTLSKSTITSSRSNRVNNRRLIADINAQKQALPTQSGEGDVLRFNQLKKRKK
PVRFARSAIHNWGLYAEENITANDMIIEYVGEKVRQQVADMRERRYLKSGIGSSYLFRID
ENTVIDATKHGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIERGGLIHSKLLLSI
YDRLLTFCVDEELTYDYKFEREWDSDDRIPCLCGSTGCKGFLN
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgcctccgccggctttgcagacttcttcccaacggcgccctcggtcctgcag
aagaagcgcagcagcaaggccgctgccggccaggacgcgggcagcaggctcaggggcagg
tcggccgccgcagacttcttcgcggaggagcatcacgacgacgaggagcatgctgcggga
ggggggccctcgccctcgtccgcatcctcttccaccgcagagcagacggagacagctacg
cccaccgatccctactctgctggttctgctggttctgctggctctgctgccggttctgcg
gctgctgcgaatggcggcgtcgttgcgagagtaggctcctccagctcgacggccacagag
tcctcctcctcggccgcggccaccacgacgctcaacggcatgtccgcctgcgccctcacg
cccctgacaaccaccgactcctcgccgccgcgcaagtccggcagccccatgctctcttcc
tcgcggctggccgactctgagcagtcttccatctccaccgctacctctgcctctgcctct
gcctccgccgtggaatatgagaaataccaccatcaccatcaccatgaccaggaccacgcc
aaggccgtcgttgctagtagtaggctgcctcctccgcccaggggctacaagctcgtctac
gacccggacctggacaagaggcctcctgcgtccagagacaagcgccggaaacctcagtac
gtcgccttcggtgaaggtgagcccgcctcagacgctgccgtggccgccgctgctgaaccc
gagttgggccagaaccttggcccggcatcaccagcagtagtatcagacccccggagagct
atcccaaactacacccgcggcgccgccagcaagcaaaagacaaagtacagaccggctccc
tacaccctcaagccatgggcctacgatccagctacctctatagggcccgggccgcccacc
cagatcgtcgtcaccggctacgaccccctcaccaccgtggctcccatcagcgccctcttc
tctagcttcggcgagatcgcggagatagacaacagaacggatcccaccacgggccgcttc
ctcggtgtctgctccatcacctacaaggacaccaggtctctgcgtggcggctctcctctc
acagctgcccagtccgcccggagagcgtacctcgagtgcaagaaggaacagcgcatcggt
actcggcgcatcagagtagagctcgaccggaactccgctgcttgcaaccgtatcgtcgca
aagctcattgctctgcagaagcaggaacagctggctgtctttgaacaacagaatagtgat
gccgctgctgctgctgcgtctaagaaatccgacattccccctcctcctccacctctacct
ctactacctaccgggcccaaagcagaaaccgaaccatcatcgcaatcacaatcacaacca
aaggataatgtaccgccccctacagcccccaagggaccatctggtaaatcctctctacac
ccggccctgcagctccaaccaccagacggacctcgcgcggcaccaaaaccaccctctctc
gtcgaagagacccccatcctagaccagatcaaacgagacccttacatcttcattgcacac
tgctacgttcccgtcctcagcaccaccgtaccccatctagaacgacgtctcaagctatac
gactggaagtccgtccggtgcgacaacacaggttactatgtcttgttcgaaaactcccgt
cgaggagagctcgagtgcgaacgctgctttcggggctgccacatgactgctctgttcacc
tatgtcatgaacatggagtgccagcagtacggcaacccatcctacgaacgaagtcccagc
cccgaacgagtcaaggccgagcagcgcgagaaatccgaaaaggcacggctcaagcgggag
acagagctggacgtggaagaggagaagcgtctacgggctgaaaacgtcgatccaaccacc
gaggtcgttgccattgccatccgtgagctcagggataagcttctggaagatatcaagact
cgcattgccgctccggcactatacgacttcctggatccggaccggcaccgcgcaaagaga
cagaagctaggcatcgctgacccgcagggcatcaagaagccggctttctacctcgatacc
gggctgggcgaaagcgccacggactcacgaaacagtcctgcaccgcctggtgcgcagtcg
aagaacgtcctcgccttaccgcgcatcagaaaagcacgagactttgaacgcaacaactct
gcctttgtcgacgaacgaagacgccgtcccactgtgcgcaggagggagttcagaccgctc
tatcaccggcttcaacagcttcatgacgaagatgactccgacgacgagcaccagacttcc
ttcacccgcgataccgaagaccaggagtctcggccgctctcccgcctgtccagcgaggca
gacaacgacgacgacgagaatctacggggctcccttgtgcccagtgtatctggctttgga
gactccggtctcgactcggctgggatcaaggaagagctggatgacctcgaccgtgaattg
ctgggagaaccaggtgactatgaacgtgtctcgaagaaacggaaacgactcagtctggag
ctgctggagatggagaagcggcggaagacagtggacgaactattcggtgtcgatacgtct
catctcggccaggaaccggacgacgacctgtctgctctcgtggactcgcaggcccaaaga
ctcggcaaagaaaagggcaagaaaccgaagaggaagaccaagaagcagcttctcgaggag
aagaaggctcttaaacttgctgaactccaggctgctgcggatcagggcctgattcccaaa
gttgacgatctcgatctcgccgtcacgcctattgaaggggaacttgacatcgaggccaag
gaggaagagtatgaggaagaagaggaggaagacggatacgtcaagccagaggtagaatgg
ggattgtcaactaccgagcccaagcccacagtcgaagacgacgaaggcatcgttctcgac
ctcgacggatggcagaacatagtcaaggacacagaagaccttcgattcctccgagaagct
ctagaatccacctcgctccaatccgaacccaacacccccatcatcaccaacgtcacagcc
tgggcttggaaccagaaacaaatcaaggccatcaacagccacggcgcccgcggtcccgtc
cactccgaaataaagatagacggctactacgtccccaacccaagtggctccgcccgcacc
gacggccgcaaacgtatcctcgagtccgaaaaatccaaatacctccctcaccgcatcaag
gtccaaaaggcccgcgaagaacgcgaagccctagctaaaagcgaccctaccgccgccgcg
gacgcagctcgagtcatcgccgccaaaaccctctccaaatcaaccattacctcctcccgc
tccaaccgcgtcaacaaccgccgtctaatagccgacatcaatgcgcagaaacaagctctg
cccacccaaagcggcgaaggagacgtgctgcgcttcaaccagcttaagaaacgcaagaag
cccgtccgttttgctcgctcggcaatccacaattggggtctgtatgccgaggaaaatatc
accgcgaacgacatgattatcgaatacgttggtgagaaggtccggcagcaggtggctgat
atgcgtgagcgacggtacctcaagtccggcattggcagcagttacttgtttcgcattgat
gagaataccgtcatcgacgctacgaagcatggtggcattgcgcgctttatcaatcatagc
tgcacgcccaactgcacggcgaagatcatcaaggtcgacggaagtaagcgtatcgtcatt
tatgccctcagggacattgagagaggtgggttgatccattcaaagctattgttatctatt
tatgataggttgctaactttctgtgtagatgaggaattgacgtacgactacaagttcgag
cgagagtgggatagcgatgaccgtatcccgtgtctctgtggctcgacgggctgcaaggga
ttcctcaactaa

DBGET integrated database retrieval system