KEGG   Arthroderma benhamiae: ARB_01036Help
Entry
ARB_01036         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARB_01036
Translation factors [BR:abe03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ARB_01036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MRHEHLAWLNLRKSEDEESTPPSSPPPVAAVARRKFDDEEDSDDVCGLFLSLVYEGIIGG
LTGNKQVLDDWEAAEDSEVEREKAQKAAAAKAKAEAEALANKKSRSQRIAEHQAAAARRR
AEQESEEESDSEEDLAAKREKLRRTEQDADLKHAEDLFGDIDLNRTRNRTAPSKSVISDA
NDPTKSIDLASIPLFKPCTKPQFTALTNALVPLLTAQAKKPAYTLWLQDFTKQLVKDLPS
QEIKKIASAMTAASNEKLKEEKAADKSGKKTKAAKTKTSLVATRGADLNAYDDVGDDLGD
DDFM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacgaacaccttgcttggttaaacctccggaagagcgaagatgaagagagtacg
cctccatcgtcaccaccaccagtagctgccgttgcgcgccgcaagtttgatgacgaagaa
gacagtgacgatgtatgtggtctattcttatctttagtttatgaaggtattatcggcgga
ctaacaggaaataaacaggttctcgatgactgggaggctgccgaggacagcgaagttgag
cgtgagaaggcccagaaggccgctgctgccaaagcaaaggccgaggccgaagcgttagca
aataagaagagccgctcccagcggatagccgagcaccaggccgccgctgcacgacgacga
gcagagcaagagtcggaggaagaaagcgattcggaagaagacctagccgccaagcgtgag
aagctacgccgaaccgaacaagatgcggacctgaagcatgccgaagacctattcggagac
atcgacttgaaccgcacccgcaaccgcaccgcacccagcaagagcgtgatatcagatgcc
aacgacccgaccaaatccatcgatctcgcctcaattcctctcttcaaaccctgcacaaaa
ccacaattcacggccctgaccaatgccctcgtgccactactgacagcccaggccaagaag
ccagcatataccctctggctgcaggacttcaccaagcaactagtcaaggatctccccagc
caggaaatcaagaagattgccagtgccatgacggctgccagcaacgagaagctcaaggaa
gaaaaggccgctgataagagtggaaagaagaccaaggccgctaagaccaagactagcctt
gttgctactcgtggagcagacctaaacgcttatgatgatgttggtgacgatcttggagat
gatgattttatgtga

DBGET integrated database retrieval system