KEGG   Arthroderma benhamiae: ARB_01080Help
Entry
ARB_01080         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
abe  Arthroderma benhamiae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:abe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ARB_01080
Exosome [BR:abe04147]
 Exosomal proteins
  Proteins found in most exosomes
   ARB_01080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1609 aa AA seqDB search
MHWNKNIIALKAQGKTIQVFDLQAKQKLKSAVMTEDVVFWKWYSETSIGLITESSVYHWN
VFDPTQHAPLKMFDRIANLASCQIISYRVNEEEKWMVVVGISQQQGRIVGTMQLHSVERG
ISQHIEGHAAAFATIKVDGSPLPHKLFTFAVRTATGAKLQIAEIDHQEPNPKFQKKAVEV
YFPQEATNDFPVAMQVSEKYDVVYLITKFGFIHLYDLETGTCIFMNRISSETIFVTTPNS
DSTGIVGVNRKGQVLSVSVDEGTIIPYLLENPANTSLAVKLASKAGLPGADNLLQRQFEQ
LLSQGNYAEAAKIAANSPRGFLRTADTINRLKAVSQSGQGMSVILQYFGMLLDKGSLNVY
ESVELTRPVLQQNRKHLLEKWLGEDKLECSEELGDIVRPHDMNIALNIYLKANVPHKVVA
GFAETGQFDKILAYSKQVGYQPDYVQLLQHIVRVNPEKCAEFAGQLANDDSGALVDLDRV
VDVFVSQNMIQQATAFLLDALKDNKPEHAKLQTRLLEMNLVNAPQVADAILGNEMFTHYD
KARISQLCENAGLYQRALENTDDSTVIMRNIVRTDKLNPEWLIEFFGRLSVEQSLECMNE
MLHSNLRQNLQAVVQIATKFSDLLGPTNLIQLLEKYRTAEGLYYYLGSIVNLSEDADVHF
KYIEAATRMGQMTEVERICRDSNYYNPEKVKNFLKEAKLAEQLPLITVCDRFNFVHDLVL
YLYQNQQYSSIEVYVQRVNPSRTPAVVGGLLDVDCDESIIKNLLTTVDPASIPIDELVAE
VEKRNRLKILLPFLENTLSTGNQQQAVYNALAKIYIDSNNNPEKFLKENDLYDTLTVGKY
CEKRDPNLAYIAYRKGQNDLELINITNDNSMYRAQARYLLERADGEIWAFVLNGNNIHRR
SLVDQVIATAVPESSEPDKVSVAVKAFLEADLPTELIELLEKIILEPSPFSDNSSLQNLL
MLTAAKADKSKLMDYIHKLTEFNADEIAGMCLSVGLYEEAFEIYKKVENHPAATNVLVEH
IVSIDRAQDYAERVELPEVWSKVAKAQLDGLRISDSIASYIRAGDPSNYNEVIETATHAG
KDEDLIEYLKMARKTLREPAVDTAMAFSFARLDKLSELDDFLRGINVADVEASGDKAYAE
GYHQAAKIFFTSISNWAKLATTLVHLEDYQAAVECARKGNSVKVWKEVNAACVAKKEFRL
AQICGLNLIVHAEELQDLVRQYERNGYFDELIALLEAGLGLERAHMGMFTELGIALSKYH
PDRVMEHLKLFWTRINIPKMIRACEEANLWPELVFLYCHYDEWDNAALAMMERAADSWEH
HSFKDIVVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNRVVRMFEKSDNIPLI
KPFLLNVQPQNKRAVNNAINDLLIEEEDHKTLRDSVENHDNYDPVDLAQRLEKHELVFFR
QIAANIYRKNKRWEKSIALSKQDKLFKDAIETAAISGKPEVVEELLRYFVDIGSRECYVG
MLYACYELIRPDVVLEMSWRHGLHDFTMPYMINMLSQQVQTIEMLKKDNEERKAKEASQQ
KEEDNTPILGGSRLMLTQGPSGSMGGGAPSMFGQQTNGITPQPTGFRPF
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgcactggaacaagaacattatcgcgcttaaggcccagggcaagaccatccaggtcttt
gacctccaggcaaagcagaagctcaagtcggcagtcatgactgaagatgttgtcttctgg
aagtggtacagtgagacaagtattggcttgatcactgagtcctcggtttaccactggaac
gtctttgacccgactcagcatgctcctcttaagatgttcgaccggattgcaaatctcgcg
agctgccaaattattagctatcgtgttaatgaggaggaaaagtggatggtggttgttggt
atcagtcaacagcaaggacggatagtaggaacaatgcagctccattcggttgaacgaggc
atatctcaacacatcgaaggccatgccgccgcctttgctaccatcaaggtcgacggatca
cccttacctcataaactcttcaccttcgctgtcagaaccgcaaccggtgccaaacttcag
attgcagagatcgatcaccaggagcccaaccctaagttccagaagaaggctgttgaggtt
tacttcccacaggaggctaccaatgacttcccagttgccatgcaggtttctgagaaatac
gatgttgtctatcttatcaccaagttcggcttcatccacctctatgacctcgagactggt
acatgcatcttcatgaaccgcatttccagcgaaaccatcttcgttaccacaccaaactca
gattctactggtattgtcggtgtcaaccggaagggtcaggtcctctctgtcagtgtggac
gaaggcaccatcattccatatctccttgaaaacccagcaaacacatctctggctgttaag
cttgcatccaaggctggccttccgggtgcagataatcttcttcagagacagtttgaacag
ctcctatctcaaggaaactatgcagaggctgccaaaatcgccgccaattcgccccggggg
ttcctgcgaactgcagacactatcaaccgcctaaaggctgtatcacagtcaggtcagggc
atgtctgtaatcctccaatatttcggaatgcttcttgacaagggatctctaaacgtatac
gagagtgttgaattgactagacctgtcttgcagcaaaaccgaaaacatctccttgagaag
tggctcggcgaggataagctggaatgctccgaggagctaggtgacatcgttcggccacac
gacatgaacattgctttgaacatctacctcaaggccaatgttccccacaaggtcgttgct
ggcttcgcagagactggtcaattcgacaagatcctggcttactccaagcaagtcggctat
caacctgactatgtccagcttctacagcatattgtccgagttaacccagagaagtgtgca
gagtttgctggtcagcttgcaaacgatgacagcggtgccctcgttgatcttgaccgtgtt
gtcgatgtcttcgtctctcaaaacatgatccagcaagctactgcattcttgttggatgct
ctcaaggacaacaagcctgagcatgctaagcttcagactaggctgctagagatgaacctt
gtcaacgctcctcaggtcgccgatgctatcctgggtaacgagatgttcacccactacgac
aaggctaggatctcacaactctgcgagaacgcaggtctctatcagcgtgcgctcgagaac
actgatgattccacagtcattatgcgcaacattgtccgcacggacaaactgaaccccgaa
tggttgatagaattctttggccgcctttcagtggaacagtccctggaatgtatgaacgag
atgcttcactcaaacctccgtcaaaatcttcaagctgttgttcaaatcgctaccaaattc
tctgaccttttgggacctaccaacctcatccaattgcttgagaaataccgaactgccgag
ggtctctactactaccttggcagcatcgtcaaccttagtgaggatgccgatgttcacttt
aagtatatagaggccgctactcgcatgggccagatgaccgaagtcgagcgtatttgccgc
gacagcaactactacaatcctgagaaggtcaagaatttcctcaaggaggccaagctcgct
gaacaacttcctttgattactgtttgcgatcgattcaactttgtccatgatctagttctg
tacctctaccagaaccagcagtattcttcgatcgaagtttacgttcaaagggtcaaccca
tcaaggactcccgctgttgtcggtggcctgcttgacgtggactgtgatgagtctattatc
aagaaccttctcactactgttgacccagcttctatcccaattgatgagcttgtcgctgag
gtagagaagagaaatagactgaagattcttttgccattcctagagaacactctcagcacc
ggtaaccaacagcaagcagtgtacaatgccttggccaagatatacattgacagcaacaac
aaccccgagaagttcctcaaggagaacgacctctatgatactctaactgtcggaaagtac
tgtgagaagcgagaccctaaccttgcatatattgcataccgcaaaggccagaatgatctt
gagcttatcaacatcaccaacgacaactcgatgtatcgtgctcaagccaggtatctactt
gagcgagctgatggtgaaatttgggcctttgttttgaacggaaacaacattcacagacgg
tcccttgttgaccaggttattgccactgccgtcccagagtcttctgagccagacaaggtg
tcagtagcagtcaaggccttccttgaagcagacctgccgacagaactcattgagttgctg
gagaagatcatcctggagccgtctcccttcagtgataacagcagtttgcagaacttgctg
atgctcaccgctgccaaggctgataagagcaagctgatggactacatccacaagcttaca
gaattcaatgctgatgagattgcgggaatgtgtctgtctgttggcctgtacgaagaagcc
ttcgagatttacaagaaggttgagaaccaccctgctgccaccaatgttctcgtggaacac
attgtcagcatcgaccgtgctcaggactatgctgagcgtgttgaacttcccgaagtatgg
agcaaggtcgccaaagctcaattggatggccttcgcatctccgattctatcgcttcatat
attcgtgccggagacccttcaaactacaatgaagttatcgaaaccgctacccatgctggc
aaggatgaggacctcattgaatatctcaagatggcccgcaagactcttcgagagcctgct
gtcgatactgccatggccttcagctttgctagactcgacaagctttccgagcttgacgat
ttcctccgtggaatcaatgttgctgatgttgaagcttccggtgacaaggcctatgccgag
ggataccaccaagctgcaaagatattcttcaccagcatctccaactgggcaaagcttgca
actacacttgtccatctcgaggactaccaagctgctgttgagtgtgctcgcaagggcaac
agcgtcaaggtctggaaggaggttaacgcagcctgcgttgccaagaaggaattccgcctt
gctcagatttgcggcttgaacctgatcgtgcatgctgaggagctacaagatctggtccgc
cagtatgagcgtaatggctacttcgacgagctcattgctctgcttgaggccggtcttggt
cttgagagagcccacatgggtatgttcactgagctaggaattgccctgtcgaagtaccat
ccagaccgtgtgatggagcacctcaagttgttctggacccgaatcaacattcccaagatg
attcgcgcgtgcgaggaagccaacctatggcccgagctagttttcctttactgccactac
gacgaatgggataacgcggcgctagcaatgatggagcgagcagccgattcgtgggagcat
cactctttcaaggatattgttgttaaggttgccaacctggagatctactaccgtgccctg
aacttttatctgcaagaacaacccctgctgctgacggacctactccaagtccttactccc
cgcatcgacgtcaaccgggttgttcgcatgtttgagaagtctgacaacatccccttgatc
aagccattccttctcaatgtacagccacagaacaagcgtgcggtcaataatgccattaac
gacctgttaattgaagaagaagatcacaagactctgcgagactcggttgagaaccatgac
aactacgatcccgtcgacctggcgcagaggctggagaaacacgagcttgtattcttccgc
cagattgcagccaacatctaccgcaagaacaagcgatgggagaagtccatcgccctctcg
aagcaggacaagctgttcaaggatgctatcgagaccgctgcgatctcaggcaagcccgag
gttgtcgaggagctgttgcgctacttcgtcgacattggtagccgtgagtgctacgtgggc
atgctatacgcctgctacgagcttatccgccccgatgtggtattggaaatgtcgtggcgc
catggcctccatgacttcacgatgccttacatgatcaacatgctgagccagcaagtgcag
accattgagatgttgaagaaggacaatgaggagcgtaaggcgaaggaagcctctcagcag
aaggaagaggacaacacgcccatcctcggaggctcgagactgatgctgacgcaaggtccc
agcgggtcaatgggagggggtgcaccgtcgatgtttggacagcagaccaacggcataacc
ccccagccaaccggcttccggccattctaa

DBGET integrated database retrieval system