KEGG   Arthroderma benhamiae: ARB_01116Help
Entry
ARB_01116         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abe  Arthroderma benhamiae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:abe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:abe01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 470 aa AA seqDB search
MGDAGLSTVQPAQAQAQAQTPQQQQQQDKKPHITDTKMTLANWYQHVNWLNVTLILGIPL
SGCIQAFWVPLQLKTAIWSVVYYFMTGLGITAGYHRLWAHSSYSATLPLRVYLAAVGGGA
VEGSIRWWARDHRAHHRYTDTDKDPYSVRKGLLYSHIGWMIMKQNPKRIGRTDITDLNED
PVVVWQHKHYIKVLLTMGFLFPALVSGLGWGDWLGGFIYAGILRVFFVQQATFCVNSLAH
WLGDQPFDDRNSPRDHVITAFVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWTIWIWKQ
LGLAYDLKQFRANEIEKGRVQQLQKKIDQRRAKLDWGIPLDQLPVMEWEEYVEQAKNGRG
LIAVAGVVHDVTDFIKDHPGGKAMINSGIGKDATAMFNGGVYNHSNAAHNLLSTMRVGVI
RGGCEVEIWKRAQKENKEVDFVRDESGNRIIRAGSQVTKIPESFPSAGAA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgccggtctgtcgacagtccagcctgctcaggctcaggctcaggctcagact
cctcagcagcagcagcagcaggacaagaagccgcatatcacagataccaagatgaccctc
gccaactggtaccagcacgtcaactggctcaacgtcaccctgatcctgggaatccctctg
tctggctgcatccaggctttctgggtgccgctgcagctcaagactgccatctggtcggtg
gtctactacttcatgaccggcctgggaatcacagctggataccatcgtctctgggctcac
tcctcgtactctgccactctccccctgagagtctacctggctgccgtcggtggtggtgcc
gtggagggatctatcagatggtgggctcgcgaccaccgtgcccaccaccgctacaccgac
accgacaaggacccttactctgtccgcaagggactgctctactcccacatcggctggatg
atcatgaagcagaaccccaagcgcatcggccgtactgacatcaccgacctgaacgaggat
cccgtcgtcgtctggcagcacaagcactacatcaaggttctcctcaccatgggcttcctc
ttccctgcgcttgtcagcggtctcggatggggcgactggctcggcggattcatctacgcc
ggcatccttcgcgtcttcttcgtccagcaggccaccttctgcgtcaactccctcgcccac
tggctcggagaccagcccttcgacgaccgcaactccccccgagaccatgtcatcaccgcc
ttcgtcaccctcggcgaaggataccacaacttccaccacgagttcccgtcagactaccgc
aacgccatcgaatggcaccagtacgaccccaccaaatggaccatctggatctggaagcag
ctcggcctcgcctacgacctcaagcagttccgcgccaacgagatagaaaagggccgtgtc
cagcagcttcagaagaagatcgaccagcgccgtgccaagctcgactggggtatcccgctc
gaccagctgcccgtcatggagtgggaggagtacgtcgagcaggccaagaacggccgtggt
ctgattgccgtggccggtgttgtccacgacgttaccgacttcatcaaggaccaccccggc
ggcaaggcgatgatcaactctggcatcggcaaggacgctaccgccatgttcaacggcggt
gtctacaaccactccaacgccgcccacaacctgctctcgaccatgagagtcggcgtcatc
cgtggaggatgcgaggtcgagatctggaagagagcccagaaggaaaacaaggaagtcgac
tttgtacgtgatgagtctggaaaccgtatcattcgtgctggttcacaggtgaccaagatc
cctgagtcgttcccgtctgctggcgccgcttaa

DBGET integrated database retrieval system