KEGG   Arthroderma benhamiae: ARB_01116Help
Entry
ARB_01116         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abe  Arthroderma benhamiae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARB_01116
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ARB_01116
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ARB_01116
Lipid biosynthesis proteins [BR:abe01004]
 Desaturase
  First
   ARB_01116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 470 aa AA seqDB search
MGDAGLSTVQPAQAQAQAQTPQQQQQQDKKPHITDTKMTLANWYQHVNWLNVTLILGIPL
SGCIQAFWVPLQLKTAIWSVVYYFMTGLGITAGYHRLWAHSSYSATLPLRVYLAAVGGGA
VEGSIRWWARDHRAHHRYTDTDKDPYSVRKGLLYSHIGWMIMKQNPKRIGRTDITDLNED
PVVVWQHKHYIKVLLTMGFLFPALVSGLGWGDWLGGFIYAGILRVFFVQQATFCVNSLAH
WLGDQPFDDRNSPRDHVITAFVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWTIWIWKQ
LGLAYDLKQFRANEIEKGRVQQLQKKIDQRRAKLDWGIPLDQLPVMEWEEYVEQAKNGRG
LIAVAGVVHDVTDFIKDHPGGKAMINSGIGKDATAMFNGGVYNHSNAAHNLLSTMRVGVI
RGGCEVEIWKRAQKENKEVDFVRDESGNRIIRAGSQVTKIPESFPSAGAA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgccggtctgtcgacagtccagcctgctcaggctcaggctcaggctcagact
cctcagcagcagcagcagcaggacaagaagccgcatatcacagataccaagatgaccctc
gccaactggtaccagcacgtcaactggctcaacgtcaccctgatcctgggaatccctctg
tctggctgcatccaggctttctgggtgccgctgcagctcaagactgccatctggtcggtg
gtctactacttcatgaccggcctgggaatcacagctggataccatcgtctctgggctcac
tcctcgtactctgccactctccccctgagagtctacctggctgccgtcggtggtggtgcc
gtggagggatctatcagatggtgggctcgcgaccaccgtgcccaccaccgctacaccgac
accgacaaggacccttactctgtccgcaagggactgctctactcccacatcggctggatg
atcatgaagcagaaccccaagcgcatcggccgtactgacatcaccgacctgaacgaggat
cccgtcgtcgtctggcagcacaagcactacatcaaggttctcctcaccatgggcttcctc
ttccctgcgcttgtcagcggtctcggatggggcgactggctcggcggattcatctacgcc
ggcatccttcgcgtcttcttcgtccagcaggccaccttctgcgtcaactccctcgcccac
tggctcggagaccagcccttcgacgaccgcaactccccccgagaccatgtcatcaccgcc
ttcgtcaccctcggcgaaggataccacaacttccaccacgagttcccgtcagactaccgc
aacgccatcgaatggcaccagtacgaccccaccaaatggaccatctggatctggaagcag
ctcggcctcgcctacgacctcaagcagttccgcgccaacgagatagaaaagggccgtgtc
cagcagcttcagaagaagatcgaccagcgccgtgccaagctcgactggggtatcccgctc
gaccagctgcccgtcatggagtgggaggagtacgtcgagcaggccaagaacggccgtggt
ctgattgccgtggccggtgttgtccacgacgttaccgacttcatcaaggaccaccccggc
ggcaaggcgatgatcaactctggcatcggcaaggacgctaccgccatgttcaacggcggt
gtctacaaccactccaacgccgcccacaacctgctctcgaccatgagagtcggcgtcatc
cgtggaggatgcgaggtcgagatctggaagagagcccagaaggaaaacaaggaagtcgac
tttgtacgtgatgagtctggaaaccgtatcattcgtgctggttcacaggtgaccaagatc
cctgagtcgttcccgtctgctggcgccgcttaa

DBGET integrated database retrieval system