KEGG   Arthroderma benhamiae: ARB_01423Help
Entry
ARB_01423         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abe  Arthroderma benhamiae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_01423
   01230 Biosynthesis of amino acids
    ARB_01423
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_01423
   00051 Fructose and mannose metabolism
    ARB_01423
   00562 Inositol phosphate metabolism
    ARB_01423
Enzymes [BR:abe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARB_01423
Exosome [BR:abe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARB_01423
  Exosomal proteins of bladder cancer cells
   ARB_01423
  Exosomal proteins of melanoma cells
   ARB_01423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
MAGPATTGVTYPALPKTLLIISLKMYFTPSRTLEYLRELLEPRNEIVCARNRSKLLLALI
PDFLTVYPCSEVVKEFTTKQPGAQQSTAESVPGPLSQPPSFLLGAQDCFWEAAGPYTGEV
SPASLRSMNVSIVELGHAERRAIFKETDEQVGRKAAAVSAQGMVPLVCVGEIPVPGPVMS
EAVGVAVKECEVQVRAVLDAIPQDAPCIFAYEPVWAIGQPVPAGVDHISAVVQGIRSVID
RVRGGSSRGEIRVIYGGSAGPGLWAQGGLGKAVDGMFLGRFAHEIEGVRKVVREVEESLE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggccggtccagcaacaacgggggtgacatacccagctctcccgaagacactcctaata
atctcgttaaagatgtatttcaccccttcgcggacgctggaatacctacgagaattgctc
gagccacggaacgagatcgtctgcgccagaaacagatcaaaactcctactcgccctcatc
ccggacttcctgaccgtctatccatgctctgaggtggtcaaggagttcaccaccaagcag
cccggtgcgcagcagtcgacggcggaatctgtcccgggacccttgtcgcaaccaccttcc
ttcctgctcggagcccaggattgcttctgggaggctgcgggcccgtatacaggggaagtg
tcgcccgccagtctacgctcgatgaacgtgtcgatagtcgaattgggccatgcagagcgc
cgggcaatcttcaaggaaacagacgaacaggtcgggcggaaagctgcagccgtcagcgca
caggggatggtcccacttgtgtgtgtgggcgaaatacccgtccctgggcctgtgatgtca
gaggctgttggagtggcggtaaaagagtgtgaggttcaggtcagagcagtgcttgatgcg
attccgcaggatgcgccgtgtatctttgcctacgagccagtatgggcaattggacagcca
gttccagctggcgtcgaccatatatctgccgtggttcaggggatacggagcgtcatcgac
agggtgcgcggcggctcgagcagaggggagatcagagtgatatatggaggcagtgcaggg
ccggggctttgggcgcaaggcgggctagggaaggctgtcgatggcatgttcctgggtcgg
tttgcccatgaaatcgaaggagtacggaaggtagtccgagaggtcgaggagagccttgaa
taa

DBGET integrated database retrieval system