KEGG   Arthroderma benhamiae: ARB_01673Help
Entry
ARB_01673         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
abe  Arthroderma benhamiae
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARB_01673
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     ARB_01673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 458 aa AA seqDB search
MAKEAVAAVAERGQTGITNVNACVSTTEASRASKDNTSWREWMVANQIGCSLSILGAILA
VHTFIPSLRAYTTPYLELPHYHPETGKYTQGLDDVYFIISSMLGFTATRAIVIDWLFYPI
ASQLGLRHKQSIRFAEQGWLLVYYLAFWAYGMNIWYHSSYWYNFRAIWADWPTREVSGSV
KLYCLLQLSFWVQQIFVIHIEAKRKDHAQMFIHHIITSTLLGSAYVYSFYNVANVVLCLM
DIVDYMLPFAKMLKYLGFERACTVAFGVFVTTWIVARHFIYMGLWWSIHKTVPTDVPFGC
YSGITGKQLSTGSPDLLAHIFNPFLDLNGPICMTGTIKVIFLGMLLLLQVLSLIWLGMII
KVALGVLWTGSSAEDTRSDDEEDVDAGEPKEKAGTSSARIMSPPSGSEGSAWSRSVMPNG
SNHQSHPVRIRTTRGRVTLSDHNDRKALLGRIGCDKPT
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaggctgtcgccgcagtcgctgaacggggccagactgggataaccaacgtc
aatgcctgtgtgtccactaccgaggccagcagggcgtccaaggataacacttcctggcga
gaatggatggttgcaaaccagataggctgctcgctctcgattctgggtgcgatactcgcc
gtacacactttcattccgtctctaagggcatacacgactccgtacctcgagctgcctcat
tatcaccccgagactggaaagtacacgcagggactggatgatgtctacttcatcatcagc
tccatgctgggctttacagctaccagagctattgtgattgactggctgttctaccccatt
gcttctcaattgggcctgagacacaagcaatcgatacgctttgccgagcagggatggctt
ttggtctactaccttgccttctgggcctatggaatgaacatctggtatcattctagctac
tggtacaatttccgtgctatatgggccgactggcctacccgagaggttagcggcagcgtc
aaactgtactgcctcctgcagctatccttttgggtacagcagatattcgtcattcacatt
gaagccaagcgcaaggaccacgcgcagatgtttatccaccatatcataaccagcactctc
ctcggatccgcatatgtttatagcttctacaatgtcgcaaacgtcgttctctgccttatg
gatattgttgattatatgctaccgttcgccaaaatgctaaaataccttggattcgagcgc
gcctgtacagttgctttcggtgtcttcgtcacaacctggatcgttgctcgccatttcatc
tacatgggcttgtggtggtccattcacaaaacggtgcccaccgatgtgccgtttgggtgt
tactcgggtatcacaggcaagcagttatcaactggctcgcctgatctcctggcccatatc
ttcaacccgttcctcgacctcaatggcccaatctgtatgactggcacgatcaaggttatc
ttcctcggaatgttgctgctcctacaagttctctcactcatctggcttggtatgatcatc
aaagttgcgctgggcgttttgtggactggctcaagtgcagaggatacaagaagtgatgac
gaggaagacgttgacgctggtgagccgaaggaaaaggccggcacctcttcggcaagaatc
atgagcccaccatctggctcagaaggcagcgcctggtcacgatcagtcatgcccaacgga
tcgaaccaccagagccacccggtgcgaataagaacgacccgtggacgagttacgttaagt
gaccataatgatcgaaaagccctccttggtagaattggctgcgacaagccaacatag

DBGET integrated database retrieval system