KEGG   Arthroderma benhamiae: ARB_01717Help
Entry
ARB_01717         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
abe  Arthroderma benhamiae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:abe00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abe00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2241 aa AA seqDB search
MPAIPSSPEPKGPSREPPFPSSPSTGGVVAYNNELHGLRTTTSGAIFSPASMQLGSKKGR
PVCLELEDGTVYRGFNFGAERSIAGELVFQTGMVGYPESLTDPSYRGQILVITFPLVGNY
GVPSRDKMDELLKGLPKHFESNQIHVAGLVVASYCGEAFSHFLAESSLGEWLKEQNVPAI
YGVDTRALTKRIREKGSMLGRMLLRKETSVSHDSAVEQQPENWRENYEVLDWEDPNKRNL
VDDDVGLKYNQLRCLLSRGVEVLVVPWNYDFPNLAGKEYDGLFLSNGPGDPATLASTVSH
LKIALKENKTPIFGICLGHQLLARAAGASTLKMKFGNRGHNIPCTSMLSGRCYITSQNHG
YAVDSKTLPEGWEELFVNANDASNEGIRHASRPLFSVQFHPESTPGPRDTEFLFDVFINT
VKECLESKDALSKPVNFPGGTIKENTAAHPRVHVKKVLILGSGGLSIGQAGEFDYSGSQA
IKALNEEGIYTVLINPNIATIQTSKGLADKVYFLPVNAEFVRKVIKRERPDAIYVTFGGQ
TALQVGIQLKDEFEELGVKVLGTPIDTIITTEDRELFARSMEVIGEKCAKSASASNLEEA
MEAVRGIGFPVIVRAAYALGGLGSGFAENDDQLRDLCTKAFAASPQVLIERSMKGWKEIE
YEVVRDARDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGV
VGECNIQYALNPFSREYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEISNS
VTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAI
RAIDFHNLGFNETSALMSIKNELQTPSDQRLFAIANAMHSGYTVDEIWELTKIDKWFLRK
LEGLSLFGKQMSSYNATTVPIPLIRQAKQLGFSDRQLARFLSSNELAVRRMRVEAGIIPF
VKQIDTVAAEFPAYTNYLYLTYNGSENDVAFDDQGIMVLGSGVYRIGSSVEFDWCSVRTI
RTLRAQGHKTVMVNYNPETVSTDYDEADRLYFENITLETVLDIYQLESSSGVAISMGGQT
PNNIALPLHRLNVKILGTSPEMIDTAENRYKFSRMLDRIGVDQPAWKELTSIEEATAFCD
KVGYPVLVRPSYVLSGAAMNTVYSQDDLANYLDQAAEVSREHPVVITKYIENAKEIEMDA
VAKNGVMCGHFISEHVENAGVHSGDATLIVPPQDLDPETVRRIEEATSKIGNALNVTGPF
NIQFIAKDNEIKVIECNVRASRSFPFVSKVMGVDLIEMATKAMIGKPFEAYPPVNIPQRY
VGIKVPQFSFSRLSGADPVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPEKNILVS
MGSFKDKMEMLPSITKLHKMGFNLFATAGTADFLREHGIPVKYLELLAGDGEDLKSEYSL
TQHLANNLIDLYINLPSSNKFRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKILIEAMS
RRYDLSVAPIDFQTSHRTVSLPGLINVAAFVPGIAEKDSADFQEVTKASIAAGFSMIRVL
PVGINSFVTDAQALKLAQLNSQKGSYCDFNFSVTATATNADQVDLISSEVGSLFIPFNHL
AGNINKVATVTTHFASWPSNKPIITDAKGTDLASILLLASLHNRNVHVMSVTSQEDIKLI
ALSKEKGLRVTCDVSIYSLFLSQETFPESCHLPTKKAQESLWEHLGTIDVFSVGSLPYET
AGKEASPTVGLADALPILLTAVSEGRLTIDDITKRLYENPKRIFELHDQQDTFVEVEVDR
PYVFKSQGAWSPFTGKTLRGSIQRVNFQGKTACLDNELLSDAPKGMDMSSHTPAPPQSPS
MKEMAPRSPMAMGSIGRRLSFTTTPQARPSPLKQADSLATADELGPPLYATPSTGGTPSL
QELLSRSTFRHKHILSVNQFNRSDLHLLFTVAQEMRLGVQRQGVLDILKGRVLCTLFYEP
STRTSASFDTAMQRLGGRTVAIATQHSSAQKGETLQDTIRTLACYSDAVVLRHPEESSAS
TAAKFSPVPIINGGNGSQEHPTQAFLDLFTIREELGTVSGITVTFTGDLKHGRTVHSLIK
LLQFYQVRIQLVSPKALSLPEDIRQQVIRSGQLIVETNELTPEVVARSDVLYCTRVQKER
FADQEEYERLKNSFVIDNSIMNQAKSQMVVMHPLPRNAEIDEQVDFDQRAAYFRQTGVFG
TLYQFLCHICVTKVLFDFMSV
NT seq 6726 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattccctcttctcccgagcccaagggcccctcgcgagaaccaccgttccct
tcaagcccttcaaccggtggtgttgtcgcatacaacaacgaactccatggtctccggacc
accacaagtggagccatattttctccagcttcaatgcaattgggctcgaagaaaggaaga
cctgtctgtcttgagctcgaggatggcactgtctacagaggattcaactttggagctgag
aggagcattgccggagagttggttttccaaactggcatggtggggtatcctgaatccttg
acagatccctcgtatcgtggtcagatcctggtcataacgtttcctctcgttgggaattat
ggtgtgccgtcgcgtgacaagatggatgagctgttaaagggcctgccaaagcactttgag
tcgaaccagattcatgttgccggcttggtggtagctagctactgtggtgaagctttctct
cacttcctagccgaaagctctctcggtgaatggttgaaagagcaaaatgtgcccgccatt
tatggtgttgatacccgagctttgactaaacgcatcagggaaaagggtagcatgctggga
cgcatgcttctccgaaaggaaacttctgtttcccatgatagcgctgttgagcagcagcca
gaaaattggagagaaaactatgaggtgcttgactgggaagacccaaataaaagaaatcta
gttgatgatgatgtcggtttgaaatacaaccaactgaggtgcctgctctctcgtggtgtc
gaggttctcgtcgtaccatggaactacgatttcccaaaccttgcaggcaaagaatatgat
ggacttttcctctcaaacggccctggcgatcctgccaccctagcttccacggtttcccac
ttgaagatcgctctcaaggagaacaagacaccaattttcggcatctgccttggacaccaa
cttctagcaagagcagcaggtgctagtactctcaagatgaaatttggaaaccgtggacac
aacattccatgcacaagcatgctctctggtcgctgttatattacatcccagaatcatggt
tatgctgttgattccaaaactcttccggaaggctgggaggagctgtttgtcaacgctaac
gatgctagcaacgaaggaatcagacatgctagccgtccactattcagtgtgcagttccat
ccagagagtacacccggaccacgggatacagagttcctatttgatgttttcatcaacact
gtaaaggagtgtcttgagtccaaagatgctttatctaaacctgtcaatttcccaggtgga
actatcaaagagaatactgctgcacatccccgagtccacgtcaagaaggtcttgatcctc
ggcagtggtggccttagtattggccaggctggagagtttgattactctggtagccaagct
atcaaagcgttaaatgaagagggaatatacaccgttcttatcaatcctaatatcgctacc
attcagacttcgaagggactggcagataaggtgtatttccttcctgttaatgctgagttc
gttcgtaaggtgataaaacgcgagcgacctgatgctatctatgtcacatttggtggtcaa
acagcccttcaagtcggcattcagctcaaagatgaatttgaagaactgggtgtgaaggta
cttggtacaccaatcgacactattattacaaccgaggaccgtgaactctttgctcgtagc
atggaggtcattggcgaaaagtgtgccaaatctgcgtcagcttccaatttggaagaagca
atggaagccgtgaggggtattggattcccagtaatcgtcagagctgcctatgctctaggc
ggattgggaagtggttttgctgaaaatgacgatcaacttcgagacctttgtaccaaagca
tttgctgcaagtcctcaggttcttattgagaggagtatgaagggctggaaggaaattgag
tacgaggtagttcgagacgcccgcgacaactgcatcaccgtctgtaacatggaaaacttt
gatcctttaggaatccataccggtgactctatcgtcgttgcaccatcccagacactatct
gatgaagattacaatatgcttcgcaccacagctgtcaacgttatccgccatcttggagtt
gtcggcgaatgtaatattcaatacgctctcaaccctttctcgagagaatattgcattatt
gaagttaatgctcgtttatcgcgatcctcagcattggcttcaaaggctactggatacccc
cttgcatttatagctgcaaaacttggtctcggaattccactaaacgagatatctaactct
gtgaccaaggttacttgtgcctgtttcgagccttccctagactatgtcgtcgttaagatt
cctcgatgggacttgaagaaattcacccgtgtatcaactcaacttggctcctcgatgaag
agtgtaggagaagtcatgagtattggaaggacgttcgaggaagccatccaaaaagccatc
cgagctatcgatttccacaatcttgggtttaacgaaacaagtgctttgatgagtatcaag
aacgagctccaaaccccatccgaccagcgactttttgctattgccaatgctatgcactcc
ggctacactgttgatgaaatatgggaattgaccaaaatcgataaatggttcttgcgaaaa
ctcgaaggactgagcctatttggcaagcaaatgagtagctataacgctactactgtccct
attcccctcatcaggcaagccaagcaactcggattctctgaccgccagcttgcgaggttc
ctaagctccaatgagcttgctgttcggcgtatgcgtgttgaggcaggtataattcccttc
gttaaacaaatcgatacggtggcagctgaattccctgcttatacaaactacctataccta
acctacaacggatccgaaaatgatgtggcgtttgacgaccaaggtatcatggttcttggc
tcaggcgtttatagaattggatcttccgttgaatttgactggtgctctgttagaacaatt
cgcacacttcgagcacaagggcacaaaactgtcatggttaattataacccagagacagtc
agtactgattacgacgaggcagatcgtctctattttgaaaatatcaccctggagacagtt
cttgatatctaccagctggagtcatctagtggagtggcaatttctatgggcggacagacg
ccaaacaacattgccctgccactccatcgcctcaatgttaaaatccttggaacgtctcct
gagatgattgatacagctgagaaccgttacaaattctctcgtatgcttgacagaattgga
gtcgatcaaccggcatggaaagaacttactagcattgaagaagctactgcattctgtgac
aaggttggctaccctgttcttgtccgcccttcatatgtcctctcaggagcagctatgaac
actgtctactcccaagacgatttggcgaactatcttgaccaagcggccgaggtgtcgcga
gaacaccccgttgttatcacaaaatatatcgaaaatgctaaggaaatcgaaatggatgct
gtggctaagaatggtgttatgtgtggccattttatctctgagcatgttgaaaatgctggt
gtccactctggtgatgctactcttattgtcccgcctcaggacttggaccccgagacggtc
agaagaatcgaagaagcaaccagcaaaattggaaatgctctgaatgttactggacctttc
aatattcagtttattgccaaggacaatgaaatcaaagtcattgaatgcaacgtccgggct
tcgcgatctttcccatttgtctcaaaggtcatgggcgttgatttgattgagatggcgact
aaggctatgatcggaaaaccatttgaggcatacccaccagtaaatataccccaacgttat
gttggcattaaggtgccacaattttcattctctcgactctctggtgcagaccctgtactt
ggcgtagagatggcttctacaggtgaggttgcctgtttcggtcgcgatcgatacgaggca
tatctgaaagcgctcatatcgacgggatttaagttgcctgagaagaacatccttgtctcg
atgggctccttcaaggataagatggagatgcttccatctatcaccaagcttcacaagatg
ggcttcaacctttttgccactgctggtacagctgacttcttgcgggaacatggcattcca
gtgaaatacttggaacttttggcaggagatggcgaagacttgaagtctgaatactctctt
acacagcatctagcgaacaacctcatcgacctttacatcaaccttccttccagcaacaaa
ttcagacgaccagcaaattatatgagcaaaggttaccgcacccgacgaatggctgttgac
taccaaactccccttgtgacaaatgtcaagaacgccaaaatcttaatcgaagccatgtct
cgacgctatgatttgagtgtggcgccaattgatttccaaaccagccaccggactgtatcg
ttgcctggactcatcaacgttgctgcatttgttccaggtattgctgagaaggattcagct
gactttcaggaagttactaaggcatccatcgctgctggtttctccatgatccgagtcttg
cctgtaggtatcaacagctttgtcacggatgcacaagccctaaaattggcacagctcaat
tcacaaaagggttcttactgtgattttaacttctcagttaccgcgactgccacgaatgcc
gaccaggttgaccttatatccagtgaggttggctcattgttcatcccattcaatcacttg
gccggtaatatcaacaaggttgctacagtcacgactcattttgcatcttggccatccaac
aagcctatcataactgatgcaaagggtacagaccttgcctcaatacttcttctggctagc
cttcataaccgcaacgtacatgtcatgagtgttacatctcaagaagacatcaaactcatc
gcgcttagcaaagaaaaggggctaagagtgacctgcgatgtttctatatactcgttgttt
ttgtcacaggagaccttcccagagagctgtcacctgccaaccaagaaagcccaagaatcg
ctctgggaacatctcgggacgattgacgtgttcagtgttggaagtctcccatacgagacc
gctggaaaagaggcatctcccacggttgggttggcagatgcactcccaatcctcttgacc
gcagtatctgaagggcgactgaccatcgacgacattaccaaaaggctgtatgagaatccg
aagaggattttcgagctccatgaccagcaggatactttcgttgaagttgaagttgatcgc
ccctatgttttcaagagccagggtgcttggtcaccatttactggtaaaacactacgtggc
tccatccagcgtgtcaatttccagggaaagacggcgtgccttgacaatgaactactttct
gacgcacctaagggcatggacatgtcgtcccacacaccagcaccaccccagtcaccttcc
atgaaagagatggcccctcggtctccaatggcaatgggctcgattggcaggcgcttatca
ttcacgactactccacaagcgcgcccatcaccactgaaacaagctgattcccttgctaca
gctgatgagcttggaccaccactatacgctactccatccactggaggaaccccctcgctc
caggagctactttctcgctccacgtttaggcataagcatatactgtctgtcaatcagttc
aacaggtcagaccttcatttattgtttacagtagcgcaggaaatgcgactcggggtccag
cgtcaaggagttctcgatatcctcaagggtcgtgttctatgtactctgttctacgaacct
tctacccgtacttctgcctcgtttgacacagcaatgcaacgactgggtggtcggactgtg
gctatcgccacccaacattcatctgctcaaaagggagaaaccctgcaggatactattcgc
actcttgcttgctattccgatgcagttgttctacgccatcctgaggagagcagcgcgtct
acggcagccaaattctcccctgttccaataatcaatggaggaaatggaagccaggagcac
cctacccaggcgttcctcgatctctttaccattcgtgaagaattaggtaccgtgagtgga
atcactgttacgttcacaggtgacctgaaacatggaagaacagttcactccctcattaaa
ttgcttcagttctatcaagtccgcattcaacttgtttctcctaaggctctgtctttgccg
gaagacatccgccagcaagttatcaggtctggtcagctcattgttgaaaccaacgagttg
acccctgaagttgtggcccgctccgacgtcttatactgtacccgagtccaaaaagaacga
tttgcggaccaagaagaatatgagaggctgaagaacagcttcgtcattgacaattctatc
atgaaccaggcgaagagccagatggtggtcatgcatccgctcccaagaaacgctgaaatt
gatgagcaagtggactttgaccagcgcgctgcttactttagacagacgggtgtctttggc
actctttaccagtttctttgccatatatgcgtcacaaaagttttgtttgatttcatgtcg
gtttaa

DBGET integrated database retrieval system