KEGG   Trichophyton benhamiae: ARB_01717Help
Entry
ARB_01717         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K11541  carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
abe  Trichophyton benhamiae
Pathway
abe00240  Pyrimidine metabolism
abe00250  Alanine, aspartate and glutamate metabolism
abe01100  Metabolic pathways
Module
abe_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ARB_01717
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARB_01717
Enzymes [BR:abe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ARB_01717
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     ARB_01717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 CPSase_sm_chain GATase OTCace_N CPSase_L_D3 OTCace MGS Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp ATP-grasp_3 Peptidase_C26 DJ-1_PfpI TrkA_N
Motif
Other DBs
NCBI-GeneID: 9519286
NCBI-ProteinID: XP_003011962
UniProt: D4AZU7
AA seq 2241 aa AA seqDB search
MPAIPSSPEPKGPSREPPFPSSPSTGGVVAYNNELHGLRTTTSGAIFSPASMQLGSKKGR
PVCLELEDGTVYRGFNFGAERSIAGELVFQTGMVGYPESLTDPSYRGQILVITFPLVGNY
GVPSRDKMDELLKGLPKHFESNQIHVAGLVVASYCGEAFSHFLAESSLGEWLKEQNVPAI
YGVDTRALTKRIREKGSMLGRMLLRKETSVSHDSAVEQQPENWRENYEVLDWEDPNKRNL
VDDDVGLKYNQLRCLLSRGVEVLVVPWNYDFPNLAGKEYDGLFLSNGPGDPATLASTVSH
LKIALKENKTPIFGICLGHQLLARAAGASTLKMKFGNRGHNIPCTSMLSGRCYITSQNHG
YAVDSKTLPEGWEELFVNANDASNEGIRHASRPLFSVQFHPESTPGPRDTEFLFDVFINT
VKECLESKDALSKPVNFPGGTIKENTAAHPRVHVKKVLILGSGGLSIGQAGEFDYSGSQA
IKALNEEGIYTVLINPNIATIQTSKGLADKVYFLPVNAEFVRKVIKRERPDAIYVTFGGQ
TALQVGIQLKDEFEELGVKVLGTPIDTIITTEDRELFARSMEVIGEKCAKSASASNLEEA
MEAVRGIGFPVIVRAAYALGGLGSGFAENDDQLRDLCTKAFAASPQVLIERSMKGWKEIE
YEVVRDARDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGV
VGECNIQYALNPFSREYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEISNS
VTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAI
RAIDFHNLGFNETSALMSIKNELQTPSDQRLFAIANAMHSGYTVDEIWELTKIDKWFLRK
LEGLSLFGKQMSSYNATTVPIPLIRQAKQLGFSDRQLARFLSSNELAVRRMRVEAGIIPF
VKQIDTVAAEFPAYTNYLYLTYNGSENDVAFDDQGIMVLGSGVYRIGSSVEFDWCSVRTI
RTLRAQGHKTVMVNYNPETVSTDYDEADRLYFENITLETVLDIYQLESSSGVAISMGGQT
PNNIALPLHRLNVKILGTSPEMIDTAENRYKFSRMLDRIGVDQPAWKELTSIEEATAFCD
KVGYPVLVRPSYVLSGAAMNTVYSQDDLANYLDQAAEVSREHPVVITKYIENAKEIEMDA
VAKNGVMCGHFISEHVENAGVHSGDATLIVPPQDLDPETVRRIEEATSKIGNALNVTGPF
NIQFIAKDNEIKVIECNVRASRSFPFVSKVMGVDLIEMATKAMIGKPFEAYPPVNIPQRY
VGIKVPQFSFSRLSGADPVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPEKNILVS
MGSFKDKMEMLPSITKLHKMGFNLFATAGTADFLREHGIPVKYLELLAGDGEDLKSEYSL
TQHLANNLIDLYINLPSSNKFRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKILIEAMS
RRYDLSVAPIDFQTSHRTVSLPGLINVAAFVPGIAEKDSADFQEVTKASIAAGFSMIRVL
PVGINSFVTDAQALKLAQLNSQKGSYCDFNFSVTATATNADQVDLISSEVGSLFIPFNHL
AGNINKVATVTTHFASWPSNKPIITDAKGTDLASILLLASLHNRNVHVMSVTSQEDIKLI
ALSKEKGLRVTCDVSIYSLFLSQETFPESCHLPTKKAQESLWEHLGTIDVFSVGSLPYET
AGKEASPTVGLADALPILLTAVSEGRLTIDDITKRLYENPKRIFELHDQQDTFVEVEVDR
PYVFKSQGAWSPFTGKTLRGSIQRVNFQGKTACLDNELLSDAPKGMDMSSHTPAPPQSPS
MKEMAPRSPMAMGSIGRRLSFTTTPQARPSPLKQADSLATADELGPPLYATPSTGGTPSL
QELLSRSTFRHKHILSVNQFNRSDLHLLFTVAQEMRLGVQRQGVLDILKGRVLCTLFYEP
STRTSASFDTAMQRLGGRTVAIATQHSSAQKGETLQDTIRTLACYSDAVVLRHPEESSAS
TAAKFSPVPIINGGNGSQEHPTQAFLDLFTIREELGTVSGITVTFTGDLKHGRTVHSLIK
LLQFYQVRIQLVSPKALSLPEDIRQQVIRSGQLIVETNELTPEVVARSDVLYCTRVQKER
FADQEEYERLKNSFVIDNSIMNQAKSQMVVMHPLPRNAEIDEQVDFDQRAAYFRQTGVFG
TLYQFLCHICVTKVLFDFMSV
NT seq 6726 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattccctcttctcccgagcccaagggcccctcgcgagaaccaccgttccct
tcaagcccttcaaccggtggtgttgtcgcatacaacaacgaactccatggtctccggacc
accacaagtggagccatattttctccagcttcaatgcaattgggctcgaagaaaggaaga
cctgtctgtcttgagctcgaggatggcactgtctacagaggattcaactttggagctgag
aggagcattgccggagagttggttttccaaactggcatggtggggtatcctgaatccttg
acagatccctcgtatcgtggtcagatcctggtcataacgtttcctctcgttgggaattat
ggtgtgccgtcgcgtgacaagatggatgagctgttaaagggcctgccaaagcactttgag
tcgaaccagattcatgttgccggcttggtggtagctagctactgtggtgaagctttctct
cacttcctagccgaaagctctctcggtgaatggttgaaagagcaaaatgtgcccgccatt
tatggtgttgatacccgagctttgactaaacgcatcagggaaaagggtagcatgctggga
cgcatgcttctccgaaaggaaacttctgtttcccatgatagcgctgttgagcagcagcca
gaaaattggagagaaaactatgaggtgcttgactgggaagacccaaataaaagaaatcta
gttgatgatgatgtcggtttgaaatacaaccaactgaggtgcctgctctctcgtggtgtc
gaggttctcgtcgtaccatggaactacgatttcccaaaccttgcaggcaaagaatatgat
ggacttttcctctcaaacggccctggcgatcctgccaccctagcttccacggtttcccac
ttgaagatcgctctcaaggagaacaagacaccaattttcggcatctgccttggacaccaa
cttctagcaagagcagcaggtgctagtactctcaagatgaaatttggaaaccgtggacac
aacattccatgcacaagcatgctctctggtcgctgttatattacatcccagaatcatggt
tatgctgttgattccaaaactcttccggaaggctgggaggagctgtttgtcaacgctaac
gatgctagcaacgaaggaatcagacatgctagccgtccactattcagtgtgcagttccat
ccagagagtacacccggaccacgggatacagagttcctatttgatgttttcatcaacact
gtaaaggagtgtcttgagtccaaagatgctttatctaaacctgtcaatttcccaggtgga
actatcaaagagaatactgctgcacatccccgagtccacgtcaagaaggtcttgatcctc
ggcagtggtggccttagtattggccaggctggagagtttgattactctggtagccaagct
atcaaagcgttaaatgaagagggaatatacaccgttcttatcaatcctaatatcgctacc
attcagacttcgaagggactggcagataaggtgtatttccttcctgttaatgctgagttc
gttcgtaaggtgataaaacgcgagcgacctgatgctatctatgtcacatttggtggtcaa
acagcccttcaagtcggcattcagctcaaagatgaatttgaagaactgggtgtgaaggta
cttggtacaccaatcgacactattattacaaccgaggaccgtgaactctttgctcgtagc
atggaggtcattggcgaaaagtgtgccaaatctgcgtcagcttccaatttggaagaagca
atggaagccgtgaggggtattggattcccagtaatcgtcagagctgcctatgctctaggc
ggattgggaagtggttttgctgaaaatgacgatcaacttcgagacctttgtaccaaagca
tttgctgcaagtcctcaggttcttattgagaggagtatgaagggctggaaggaaattgag
tacgaggtagttcgagacgcccgcgacaactgcatcaccgtctgtaacatggaaaacttt
gatcctttaggaatccataccggtgactctatcgtcgttgcaccatcccagacactatct
gatgaagattacaatatgcttcgcaccacagctgtcaacgttatccgccatcttggagtt
gtcggcgaatgtaatattcaatacgctctcaaccctttctcgagagaatattgcattatt
gaagttaatgctcgtttatcgcgatcctcagcattggcttcaaaggctactggatacccc
cttgcatttatagctgcaaaacttggtctcggaattccactaaacgagatatctaactct
gtgaccaaggttacttgtgcctgtttcgagccttccctagactatgtcgtcgttaagatt
cctcgatgggacttgaagaaattcacccgtgtatcaactcaacttggctcctcgatgaag
agtgtaggagaagtcatgagtattggaaggacgttcgaggaagccatccaaaaagccatc
cgagctatcgatttccacaatcttgggtttaacgaaacaagtgctttgatgagtatcaag
aacgagctccaaaccccatccgaccagcgactttttgctattgccaatgctatgcactcc
ggctacactgttgatgaaatatgggaattgaccaaaatcgataaatggttcttgcgaaaa
ctcgaaggactgagcctatttggcaagcaaatgagtagctataacgctactactgtccct
attcccctcatcaggcaagccaagcaactcggattctctgaccgccagcttgcgaggttc
ctaagctccaatgagcttgctgttcggcgtatgcgtgttgaggcaggtataattcccttc
gttaaacaaatcgatacggtggcagctgaattccctgcttatacaaactacctataccta
acctacaacggatccgaaaatgatgtggcgtttgacgaccaaggtatcatggttcttggc
tcaggcgtttatagaattggatcttccgttgaatttgactggtgctctgttagaacaatt
cgcacacttcgagcacaagggcacaaaactgtcatggttaattataacccagagacagtc
agtactgattacgacgaggcagatcgtctctattttgaaaatatcaccctggagacagtt
cttgatatctaccagctggagtcatctagtggagtggcaatttctatgggcggacagacg
ccaaacaacattgccctgccactccatcgcctcaatgttaaaatccttggaacgtctcct
gagatgattgatacagctgagaaccgttacaaattctctcgtatgcttgacagaattgga
gtcgatcaaccggcatggaaagaacttactagcattgaagaagctactgcattctgtgac
aaggttggctaccctgttcttgtccgcccttcatatgtcctctcaggagcagctatgaac
actgtctactcccaagacgatttggcgaactatcttgaccaagcggccgaggtgtcgcga
gaacaccccgttgttatcacaaaatatatcgaaaatgctaaggaaatcgaaatggatgct
gtggctaagaatggtgttatgtgtggccattttatctctgagcatgttgaaaatgctggt
gtccactctggtgatgctactcttattgtcccgcctcaggacttggaccccgagacggtc
agaagaatcgaagaagcaaccagcaaaattggaaatgctctgaatgttactggacctttc
aatattcagtttattgccaaggacaatgaaatcaaagtcattgaatgcaacgtccgggct
tcgcgatctttcccatttgtctcaaaggtcatgggcgttgatttgattgagatggcgact
aaggctatgatcggaaaaccatttgaggcatacccaccagtaaatataccccaacgttat
gttggcattaaggtgccacaattttcattctctcgactctctggtgcagaccctgtactt
ggcgtagagatggcttctacaggtgaggttgcctgtttcggtcgcgatcgatacgaggca
tatctgaaagcgctcatatcgacgggatttaagttgcctgagaagaacatccttgtctcg
atgggctccttcaaggataagatggagatgcttccatctatcaccaagcttcacaagatg
ggcttcaacctttttgccactgctggtacagctgacttcttgcgggaacatggcattcca
gtgaaatacttggaacttttggcaggagatggcgaagacttgaagtctgaatactctctt
acacagcatctagcgaacaacctcatcgacctttacatcaaccttccttccagcaacaaa
ttcagacgaccagcaaattatatgagcaaaggttaccgcacccgacgaatggctgttgac
taccaaactccccttgtgacaaatgtcaagaacgccaaaatcttaatcgaagccatgtct
cgacgctatgatttgagtgtggcgccaattgatttccaaaccagccaccggactgtatcg
ttgcctggactcatcaacgttgctgcatttgttccaggtattgctgagaaggattcagct
gactttcaggaagttactaaggcatccatcgctgctggtttctccatgatccgagtcttg
cctgtaggtatcaacagctttgtcacggatgcacaagccctaaaattggcacagctcaat
tcacaaaagggttcttactgtgattttaacttctcagttaccgcgactgccacgaatgcc
gaccaggttgaccttatatccagtgaggttggctcattgttcatcccattcaatcacttg
gccggtaatatcaacaaggttgctacagtcacgactcattttgcatcttggccatccaac
aagcctatcataactgatgcaaagggtacagaccttgcctcaatacttcttctggctagc
cttcataaccgcaacgtacatgtcatgagtgttacatctcaagaagacatcaaactcatc
gcgcttagcaaagaaaaggggctaagagtgacctgcgatgtttctatatactcgttgttt
ttgtcacaggagaccttcccagagagctgtcacctgccaaccaagaaagcccaagaatcg
ctctgggaacatctcgggacgattgacgtgttcagtgttggaagtctcccatacgagacc
gctggaaaagaggcatctcccacggttgggttggcagatgcactcccaatcctcttgacc
gcagtatctgaagggcgactgaccatcgacgacattaccaaaaggctgtatgagaatccg
aagaggattttcgagctccatgaccagcaggatactttcgttgaagttgaagttgatcgc
ccctatgttttcaagagccagggtgcttggtcaccatttactggtaaaacactacgtggc
tccatccagcgtgtcaatttccagggaaagacggcgtgccttgacaatgaactactttct
gacgcacctaagggcatggacatgtcgtcccacacaccagcaccaccccagtcaccttcc
atgaaagagatggcccctcggtctccaatggcaatgggctcgattggcaggcgcttatca
ttcacgactactccacaagcgcgcccatcaccactgaaacaagctgattcccttgctaca
gctgatgagcttggaccaccactatacgctactccatccactggaggaaccccctcgctc
caggagctactttctcgctccacgtttaggcataagcatatactgtctgtcaatcagttc
aacaggtcagaccttcatttattgtttacagtagcgcaggaaatgcgactcggggtccag
cgtcaaggagttctcgatatcctcaagggtcgtgttctatgtactctgttctacgaacct
tctacccgtacttctgcctcgtttgacacagcaatgcaacgactgggtggtcggactgtg
gctatcgccacccaacattcatctgctcaaaagggagaaaccctgcaggatactattcgc
actcttgcttgctattccgatgcagttgttctacgccatcctgaggagagcagcgcgtct
acggcagccaaattctcccctgttccaataatcaatggaggaaatggaagccaggagcac
cctacccaggcgttcctcgatctctttaccattcgtgaagaattaggtaccgtgagtgga
atcactgttacgttcacaggtgacctgaaacatggaagaacagttcactccctcattaaa
ttgcttcagttctatcaagtccgcattcaacttgtttctcctaaggctctgtctttgccg
gaagacatccgccagcaagttatcaggtctggtcagctcattgttgaaaccaacgagttg
acccctgaagttgtggcccgctccgacgtcttatactgtacccgagtccaaaaagaacga
tttgcggaccaagaagaatatgagaggctgaagaacagcttcgtcattgacaattctatc
atgaaccaggcgaagagccagatggtggtcatgcatccgctcccaagaaacgctgaaatt
gatgagcaagtggactttgaccagcgcgctgcttactttagacagacgggtgtctttggc
actctttaccagtttctttgccatatatgcgtcacaaaagttttgtttgatttcatgtcg
gtttaa

DBGET integrated database retrieval system