KEGG   Trichophyton benhamiae: ARB_01776Help
Entry
ARB_01776         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
abe  Trichophyton benhamiae
Pathway
abe00480  Glutathione metabolism
abe00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ARB_01776
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ARB_01776
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ARB_01776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Ral
Motif
Other DBs
NCBI-GeneID: 9519345
NCBI-ProteinID: XP_003012020
UniProt: D4B005
AA seq 174 aa AA seqDB search
MSSATSFYNFEPVDKKGEPFPLASLKGKVVLVVNTASKCGFTPQFAGLEELYKSITASHP
DKFTILGFPCNQFGGQDPGSNDEIQSFCQVNYGVTFPVLGKIDVNGDNTAPVFNWLKKEM
PGLMGLKRVKWNFEKFLVDADGKVVGRWASTTKPESLKSTILEEIEKAGKKSQL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggctacgtccttttacaacttcgagccagttgataagaaaggggagccgttc
ccgctcgcctcgctgaaaggcaaagtagtccttgttgtcaacaccgcgtcaaaatgcggc
tttacaccacagttcgccggccttgaagagctctacaagtcaatcacggcctcccaccca
gataaattcaccatcctaggcttcccgtgcaaccagttcggcggccaggaccccggaagc
aacgatgagatccagtccttctgccaggtcaactacggcgtcacattccctgtgctcggc
aagatagacgtcaacggcgataacactgcgccggtgttcaactggctgaagaaggagatg
cctggtctcatgggcctgaaaagggtcaagtggaactttgagaagttcctggtcgatgcg
gacgggaaggtcgtcggccgatgggcgagtaccacaaagccagagtcgctcaagtctacc
atcctggaggagatcgagaaggctggaaagaagtctcagctgtag

DBGET integrated database retrieval system