KEGG   Arthroderma benhamiae: ARB_01776Help
Entry
ARB_01776         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abe  Arthroderma benhamiae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:abe00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:abe00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 174 aa AA seqDB search
MSSATSFYNFEPVDKKGEPFPLASLKGKVVLVVNTASKCGFTPQFAGLEELYKSITASHP
DKFTILGFPCNQFGGQDPGSNDEIQSFCQVNYGVTFPVLGKIDVNGDNTAPVFNWLKKEM
PGLMGLKRVKWNFEKFLVDADGKVVGRWASTTKPESLKSTILEEIEKAGKKSQL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggctacgtccttttacaacttcgagccagttgataagaaaggggagccgttc
ccgctcgcctcgctgaaaggcaaagtagtccttgttgtcaacaccgcgtcaaaatgcggc
tttacaccacagttcgccggccttgaagagctctacaagtcaatcacggcctcccaccca
gataaattcaccatcctaggcttcccgtgcaaccagttcggcggccaggaccccggaagc
aacgatgagatccagtccttctgccaggtcaactacggcgtcacattccctgtgctcggc
aagatagacgtcaacggcgataacactgcgccggtgttcaactggctgaagaaggagatg
cctggtctcatgggcctgaaaagggtcaagtggaactttgagaagttcctggtcgatgcg
gacgggaaggtcgtcggccgatgggcgagtaccacaaagccagagtcgctcaagtctacc
atcctggaggagatcgagaaggctggaaagaagtctcagctgtag

DBGET integrated database retrieval system