KEGG   Arthroderma benhamiae: ARB_01851Help
Entry
ARB_01851         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
abe  Arthroderma benhamiae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ARB_01851
Enzymes [BR:abe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     ARB_01851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 921 aa AA seqDB search
MSFKPFRSPLPRKPQPSTTTATARVPSIPEEPLRKRRRVNTCDDGDKEVVETCDNETYYS
VLWRKPTAKKNKTWDGDGIIIARGDYGYLQDVSGREMGKIILRSSLEPGASLSISGKDVE
VESVLSRKEFLSTSNGAQKDSIEKKNNIANTPSHNSRLPSNTVSKPGMKISLNDLKTQKP
LNMSASRSYATNSSFKNPLKQSTVLPPGSSGQITPRHDPTLPGAVVMKRPSSVPPGKQIV
DVVVDPILGKHLREHQKEGVKFLYECVMGLRPFNGEGAILADEMGLGKTLQTIALIWTLL
KQNPIYGSQPVIKKALIVCPVTLINNWKKEFKKWLGSDRIGVFVADGKGNRLSDFTMGRS
YSVMIIGYERLRSVQDQLTKGPGIDIVVADEGHRLKTVQNKSSQAIQSLNTTRRIILSGT
PIQNELSEFFAMVDFVNPALLGTFKSFMRDFEGPIVGARQPNAPKKVIEKGKARSEELAE
LTSPFILRRTADILSKHLPPKTEYILFCNPTSAQRSVYHHVLASPMFQSVLRNSESALQL
ITILKKVCNSPSLLKPKVEDNGKGEDTSMSALLSSLPPNIHRCLAAGSSGKIRVLDQLLY
NLQSKTKEKVVLVSNYTSTLNLLANLLTSLDLPFLRLDGSTPATKRQALVEDFNRSPSSS
CFAFLLSAKAGGTGLNLIGASRLVLFDVDWNPATDIQAMARIHRDGQKRHCHIYRLLLKG
GIEEKIWQRQVTKLGLADSVMDQKGGIAHFSQEELKDLFRLDEISKCQTHELLGCECGGR
GETSKDIKDEDNLRAESISVSSSEDEDHELEDSDDEFPDLPKLMKASELMISGAPQPSSK
QQKAYERAKKRFLMQYSHIDTTLLNTGEQDVDGDEAVCDTNTSIEASIGDEVLLSLLKEE
KSGVGYLFKKSGFANAPLLVD
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcaagccattccgttccccacttcccagaaagccacaaccctcgaccacaact
gccacagcgcgtgtgccttcaatccccgaagagcctttgcgtaaacgaaggcgggtgaac
acctgtgatgacggtgacaaggaggtagtagaaacttgcgataatgagacatactacagc
gtactttggcgcaaacctactgctaagaagaataaaacttgggatggagacggaatcatc
attgctcggggcgactatggctacctgcaggatgtatctgggcgggaaatgggcaagatt
atactgagatctagcctggaacctggagcttcattgtctataagtggtaaggatgtcgag
gtggagtcagtgcttagccggaaggaattcctttccacttcaaatggagcacagaaagac
agcattgaaaaaaagaacaacattgcaaatactccatcccataactctcgccttccttct
aatacagtctcgaaacccggaatgaaaatttcgctgaatgatttgaagacccaaaaaccc
cttaatatgtctgcctcgcggagttatgccaccaatagctcttttaagaaccctttgaag
cagtctaccgtgttaccgccaggatcgagcgggcaaataacccctagacatgaccccact
ctacctggcgctgtggtaatgaaaagacctagctcagtcccccctggcaaacagatagta
gatgtcgtcgttgacccgattctagggaaacatctaagggagcaccagaaggagggtgtt
aagtttctttatgagtgtgttatggggctgcggcctttcaatggcgaaggagctattcta
gccgatgaaatgggtctagggaagacactgcaaacaatagccttaatttggaccctactg
aagcagaatcccatatacggttctcagccagtaatcaagaaggccctaattgtctgcccg
gttacccttattaacaactggaaaaaagaatttaagaaatggctaggcagcgatcgaatt
ggtgtatttgttgctgatggtaagggaaatcggttatcagattttacaatgggacgaagc
tatagtgttatgatcattggttatgagagactacgttctgtgcaagaccaacttacaaaa
gggcctggaatagacattgttgttgctgacgagggccatcggctgaagactgtgcaaaac
aagagttcacaggccattcaatctctaaacactacacgccgaattattctttctgggaca
ccaatccagaacgaattgagcgagttctttgctatggtggattttgtcaaccctgccctc
ctaggaacgtttaagtcatttatgagggattttgaaggcccaattgttggagctagacag
ccaaatgctcctaagaaggtcatcgaaaaggggaaggctagaagtgaagaactggcggag
ttgacgtctccgtttatcctccgccggacagctgatatcctttcaaaacacttgccgcca
aaaacagagtacatattattctgcaatcctacttctgcgcagagaagtgtataccatcac
gttctcgcctctcctatgttccaatctgtgttgagaaactctgaaagtgctttacaactt
atcactattctgaagaaagtatgcaacagcccctcgttgcttaagccgaaggtagaggat
aatggcaaaggtgaagacacatcaatgagtgctttgttatcctctctcccaccgaatatt
catcgctgtcttgctgcgggttctagcgggaagatcagagttctcgatcaattgctctat
aacctacagagtaagacgaaagagaaagtcgtcctggtgtccaattatacttctacgtta
aacctgctggcaaatctcctgacttcgctagacctcccattcttgcgtctagatggttct
acacctgccacgaaacgtcaggctctagtagaggatttcaatcgttctccgtcttcatct
tgttttgcattcttactttccgcaaaagcaggaggtacagggctgaacctcatcggagcc
agcaggcttgtacttttcgacgtggactggaacccagcaactgacatccaggcaatggca
aggattcatcgagatggccagaagcgacactgccatatctaccgtctattgctcaaaggt
ggaatagaagagaagatctggcagcgacaagtgacaaaacttggtttggcagatagcgtt
atggatcaaaagggtggcatagcccatttttcacaggaggaattgaaagatttattccgt
ctggatgagatctccaagtgccaaactcacgaattattaggatgcgagtgtggtggtcgg
ggagagacgtctaaggatataaaggatgaagacaaccttcgtgcagaatcaatctccgtt
tcttcttccgaggatgaagaccatgagctggaagattcagacgacgagttccctgatctt
ccaaagctgatgaaagcgtcggagctcatgatatctggagcacctcaaccttcatctaaa
cagcagaaagcatacgagagagccaaaaagcgtttcttaatgcaatactcccatattgat
actaccttgttgaacaccggagaacaagatgttgacggagacgaggccgtttgtgataca
aacacaagtattgaagcaagtattggagacgaagttctattgtcattgctaaaagaagag
aaaagtggggtgggatacctttttaagaagagtggctttgcgaatgctccattactcgtt
gattag

DBGET integrated database retrieval system