KEGG   Arthroderma benhamiae: ARB_01985Help
Entry
ARB_01985         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
abe  Arthroderma benhamiae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 567 aa AA seqDB search
MDPISVVVKHQGKRYEVELDPSSNGETFKFQLYSLTGVEPERQKILVKGGQLKDDTLLSS
LNAKAGQTFMMMGTPANGESNLALRKPKEAIKFLEDMTEAEVAKADGATPAGLSNLGNTC
YLNSTLQTLRLIPELQEELQRYKGTAQGSSSQFNSGWPDLTASLRDLYKLMSQTQRGFPP
IRFLDSLRTVFPQFAQQSRDGHGYAQQDAEEAWSQIISQLRQNLMIKDASDGKDSKAVSF
VDKYMSGTINSVLECDEPAAKEGGEMAVESSDVFFKLNCHIDKEINHLHDGIMASLEEKI
EKHSPTLDRDAIYTKKTRISRLPKYLTVHFVRFFWKRESQKKAKIMRKVTFPQEIDVVDF
CTDELKKQLIPVRDKVREIRKDEQDMERARKRQKIAHKREQEEKQEDRASEPLQKKKMAE
SATDQNKDKPEDKDAAPEVFKSDAEYEAEKAAALLQAKKELFSLINEDLAKDESTNKCGL
YELRGVITHQGASADSGHYTAYVKKQGKVVDGKRREEDGNWWWFNDEKVSEVPAEKIETL
SGGGESHSALILLYKAIDLPTADVLNE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggatcctatttctgttgtcgtcaaacatcagggtaaacgctacgaagtagagcttgac
ccgagctcgaatggcgagacattcaagttccagctgtactctctaacgggcgttgaaccc
gaacgacagaaaatattagtcaaaggaggccagcttaaagatgacactctcctatcttcg
ctcaatgccaaagcgggccagacattcatgatgatgggtaccccagccaacggagagtcc
aatctagcattgaggaaaccgaaggaagcaattaaatttttggaggacatgactgaagct
gaggttgcaaaggctgacggcgctacaccggctggtctttcaaatttgggaaatacatgt
tacctgaactccaccctgcagaccctgcgcctcatccccgaacttcaggaagagctgcag
agatacaaaggtaccgcacaaggtagctcgagccagtttaactcaggctggcctgatctc
acggcctcccttcgagatttgtacaaactgatgtcacaaacccagcgggggtttcctcca
ataagattcctagattccctccgtactgtcttcccgcaatttgcacaacaaagcagggat
ggacatggctatgcacagcaagatgcagaagaagcttggtcccagattatttcacaactt
cgccaaaatctcatgataaaggatgcctccgatggcaaagactcgaaagccgtttccttt
gttgacaagtatatgtcagggacaatcaactcggttttagagtgcgatgagccggctgcc
aaagaaggcggagagatggccgtagaaagctctgacgttttcttcaagctaaattgccat
atcgacaaagaaatcaaccatcttcacgatggaatcatggctagtctagaagagaaaatc
gagaagcactcacctaccctggaccgagatgctatctacaccaaaaaaactcgaatctcg
cgtctcccgaaatatctcaccgtccactttgttcgtttcttctggaaacgggaatcgcaa
aaaaaggccaaaattatgcgaaaagtcacattcccgcaggaaatcgacgtagtcgacttt
tgcactgacgagttgaagaagcagctcattccagtcagggataaagtccgcgagattcga
aaagacgaacaggacatggaacgtgcacgaaaacgccaaaagattgctcataaacgtgaa
caagaagagaaacaagaagatcgtgcatctgagcccctgcaaaagaagaaaatggccgag
tcagcaaccgatcagaacaaagacaagcccgaagataaggatgctgcgccagaagtgttc
aaatcagatgccgaatacgaagctgaaaaggcagccgcccttttacaggctaagaaagag
ctcttttctcttatcaatgaagaccttgctaaggatgaaagtacaaataagtgtggactt
tacgaactacggggtgtcattacccatcagggagctagcgccgacagtggccactacact
gcctatgtaaagaagcagggcaaggtagtggatggcaagagacgtgaagaagatggaaat
tggtggtggttcaacgatgaaaaggtttctgaggtacctgcagagaaaattgaaacacta
tccggaggtggtgaatcacactctgccctgatccttctttacaaggccatcgacttgccc
actgctgatgttcttaacgagtga

DBGET integrated database retrieval system