KEGG   Arthroderma benhamiae: ARB_02105Help
Entry
ARB_02105         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
abe  Arthroderma benhamiae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:abe00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ARB_02105
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     ARB_02105
Protein kinases [BR:abe01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   ARB_02105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 686 aa AA seqDB search
MEESNQVREGVEMQGVDGTADTPSSTSTTTTTTASASASASASASVSTTSTSAPSAAAPI
MTAPAEGRPRLPVMPATTASIRTTSGMMTPSSTPLGHVNAARRPGPLPARGSQSSGLSQD
IQEKMKAFSLSRQGAPGNGSNGNERLPGIPIAAPQATSPWSPPSVQGGAAAAPMGRTPTP
KMGGGGLAAKRGMAGGMKLSNVTGQPPGAAPGIPNASSGANGSPASLSKASGTPQSSNTP
VSAFSKYSELIDTKAGTINFKNKAIIHGGGIDFSSGQSFSISLDDVESLNELGKGNYGTV
YRVRHCRPKIRRPGLGLKGSMVGNLPDSNTNNNINNNNQNNNDSNSLDTTSNTKKSKGDL
TNIIMAMKEIRLELDEAKFTAIIMELDILHRCISPFIIDFYGAFFQEGAVYICVEFMDGG
SMEKVYSGGVPENILRKITLSTVMGLKCLKDEHNIIHRDVKPTNILVNTRGQIKICDFGV
SGNLVASIAKTNIGCQSYMAPERIAGGGHPGSSGGGTYSVQSDIWSLGLTIVECAMGRYP
YPPETYNNIFSQLNAIVQGDPPTLPDPGFSPEAKDFVASCLQKNPAARPTYANLIRHAWV
EKLMQPPTATPEATEAAEIIGSEEPTDARSPDGPDYNTDTYDKEVAAWVIEALKRRAGEA
NGRERPALHAVALDAVPKSPLLEGQS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggaagagagcaaccaggtgcgcgaaggcgtcgagatgcagggagtcgacggtactgca
gatacgccgtcgtctacctccaccaccaccaccaccaccgcctctgcctctgcctctgcc
tctgcctccgcctcagtatcaacaacttcgacctctgcacccagtgctgccgctcctatc
atgacggctcccgcggagggccgcccccgactaccagtcatgccggctactacggcctcg
attcgcactacttccggcatgatgactccctcatctacaccgctgggccatgtcaacgct
gcccgccgccctggccccctgccggcccgcggaagccagtccagcggcctgtcccaggat
atacaggagaaaatgaaggccttctccctctctcgccagggagctcccggcaacgggagc
aacggcaacgagagactacccggcatccctatagctgcccctcaggctaccagcccctgg
tcccccccgtctgttcagggaggtgccgcggctgctcccatgggacgcactcctactccc
aaaatgggcggaggaggacttgctgctaagagaggcatggccggtggtatgaaactgtca
aatgttaccggacagccccccggcgcggctcccggtatacccaacgccagctctggtgcc
aacgggagtccagccagtctgtcaaaggctagcggcaccccgcagtcctcgaataccccc
gtctcagcttttagcaagtactcggagctcatcgatacaaaggccggcactatcaatttt
aagaacaaggctattatccatggcggaggcattgatttctcctccggccagagcttcagt
atctccctggatgatgttgagtccctcaacgagctagggaaaggaaactacggtaccgtc
tacagagtacgacactgtcggccaaagatacgacggcctggcctcggcttgaaggggagc
atggtaggaaatctgccagacagcaataccaacaacaacatcaacaacaataaccagaac
aataatgactcgaactccctcgatacaacctcaaatacgaaaaagagcaagggcgacctt
acaaacatcatcatggccatgaaagagatccgtctcgagctcgacgaggccaaattcacc
gctatcattatggaactcgatatcctacatcgctgtatctcacccttcatcatcgatttc
tacggcgccttcttccaggaaggagctgtctacatctgtgttgagttcatggatggtgga
tctatggaaaaagtctactcagggggtgtgcctgaaaacattttgcgcaaaatcactctg
tcgactgtcatgggcctcaagtgtctcaaggacgaacataacatcatccatcgagatgtg
aaaccgacaaacatccttgtcaacacgcgtggacagatcaagatctgcgatttcggagtg
agcggtaaccttgttgctagcattgcgaaaacaaatattggctgtcagagttacatggcc
cccgagcgtattgcaggtggtgggcatcccggtagctccggtggaggcacgtacagcgtt
caatccgacatttggagtcttggcttgaccatcgtcgaatgtgcgatgggcaggtacccc
tacccccctgagacatacaacaacatcttcagccaactcaatgcaatcgtgcaaggggac
ccgccaactctgcccgatccaggcttctcccccgaggcaaaagacttcgtcgcaagctgt
ctgcagaaaaatcccgctgccagaccaacatacgccaatcttattcgacacgcctgggta
gaaaagctcatgcaaccccccactgctactccagaagcaacggaagcagctgaaatcata
ggatcagaagagccaaccgatgccagaagtccagatggacccgactacaacactgacacc
tacgataaggaggtcgctgcatgggttatagaagctcttaaacgccgggcgggtgaagct
aatggcagggaacgacctgctttacacgctgtagcactggacgcagtgcctaaaagccct
ttactcgaaggccagagctag

DBGET integrated database retrieval system