KEGG   Arthroderma benhamiae: ARB_02215Help
Entry
ARB_02215         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ARB_02215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 681 aa AA seqDB search
MSTPSTATATHPSHQRYGYSRHQVYHQPNPQSFPTASAASNALANPFSYTSNHQSTTNGL
SLASTPKTTAPVPSMASYSTPTVLPTAHSRRKQPDWGEFYKNGVPKEIIVIDDDDDDNTN
NDPVPVSASAVTSSTRTAPRVAPSASSSNLPANKKRRTDASSGVDVYYERPAYSASSQKY
GEGSSAAPSMSTDRTASIHTTAPTSLGSQASGSAANNAYLDDVAVGQKRKRVVTRKAARD
ELKRRELETVGDAFSSYIPPPKPPIKAKDVVVPVIRDYNANKNQKIDDEDGHYIVNPDTN
LTDKFIFFFAELTVHSPRLDSIIRLLGQGTFGKVVEAYDRQRKTRCAVKIIRSVQKYRDA
SRIELRVLSTLASNDETNRNRCIHLRDCFDFRNHICIVTDLLGQSVFDFLKANSFVPFPS
SQIQNFARQLFTSVAFLHDVNLIHTDLKPENILLVSNAYQTFTYNRTIPSSSHTTSRTAR
QRRVLLDSEIRLIDFGSATFDDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVE
FFTGDALFQTHDNLEHLAMMESVCGGKIDPKLVRQVLQGRNGHGANSAAKYFNRTKLDYP
NEDTSRASRKYVKAMKQLHEFIPATTSFNKQFLDLLRRIFVYDPKVRITAKEALKHPWFK
DTIIDDGTEAVRIRQEQQRGA
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccccttctactgctacggcaacccatccatctcaccagcgttacggatactct
cgtcatcaagtataccaccagcctaacccgcagtcgttccccaccgcgtcagcggcgagc
aatgcgcttgcaaaccccttcagctacacgtccaaccatcagtcgaccaccaacgggctt
tcgctagcatccacgcccaaaacgaccgctccagtgccttccatggcctcctacagcacg
cccacagtcctcccgactgcccacagtcggcggaaacagccggactggggagagttttat
aagaatggcgtccccaaggagataattgttattgacgacgacgatgatgataatacaaac
aacgatcctgtgcccgtctctgcttcggcggtgacctcatccactagaactgcaccccgt
gttgccccttctgcttcttcttccaacctgccggcaaacaagaaacgaaggactgacgcc
agttcaggcgtcgacgtctactacgaacgccctgcctactctgcctcctcccaaaagtac
ggcgagggctcgtctgcggcgccttcaatgtcaaccgaccgcaccgcctctattcatact
accgctcccacctcacttggctcgcaggctagcggttctgcagccaacaacgcctacctt
gacgatgtcgctgtcggccagaagcggaagcgagtcgtgacacgtaaggctgcacgtgat
gaattgaaacgaagagaactcgagaccgtcggcgatgcgttcagcagctatattcctcct
ccaaagccgcccatcaaggccaaagatgtcgttgtccccgtcatccgtgattacaacgcg
aataaaaaccagaagatcgacgatgaagatgggcattacatcgtcaacccggacaccaat
ctcaccgacaaattcatttttttttttgcagaactaacagttcattccccccggctagac
tcaattattcgccttttgggccaagggacatttggcaaggtcgtggaggcatatgataga
caaagaaagactcgctgtgcagtgaagatcatcagatcggtccagaaataccgcgatgcc
tctcggatcgaacttcgagtcctctcaactctcgcatccaacgacgagactaatagaaac
cggtgtatccatcttcgggactgtttcgatttcagaaaccacatctgcatcgtcaccgac
ttgctgggccagagcgtgtttgatttcctaaaagcaaactccttcgtcccattcccgagc
agccagatccaaaacttcgctagacaactcttcaccagcgttgcctttctacacgatgtc
aaccttatacacaccgatttgaaacctgaaaatattcttctcgtcagcaatgcttaccag
acgtttacatataaccgaaccatcccatcttcctctcacacaacctcgaggaccgctcgg
caacgacgtgtcctgctcgacagcgagattcgtctaatagacttcgggtctgcgactttc
gacgatgaataccattcctccgtggtttcgactcggcattatcgtgcccctgagattatt
ctcaatcttggatggagcttcccctgcgatatctggagtataggctgtatcttggtcgag
ttcttcaccggagatgccctcttccagacacacgacaacctcgagcacctcgccatgatg
gagagcgtttgtggtggtaaaatagacccaaaactcgtcagacaagttctacaaggtcgt
aatggacacggtgccaattctgctgctaaatatttcaaccgcaccaaacttgactatcca
aatgaagatacctccagagcgtcaagaaaatacgtaaaagcaatgaaacaacttcacgaa
tttattcctgcaacaacttcctttaacaaacaattccttgacctgcttcgccgcatcttc
gtctatgatcccaaagttcgcattactgccaaagaggccctcaagcacccatggttcaag
gatactatcatcgatgatggtaccgaggcagtccgtatccgccaggagcaacagcgtggg
gcctga

DBGET integrated database retrieval system