KEGG   Arthroderma benhamiae: ARB_02226Help
Entry
ARB_02226         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K12743  
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
abe  Arthroderma benhamiae
Pathway
Penicillin and cephalosporin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    ARB_02226
Enzymes [BR:abe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     ARB_02226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 3786 aa AA seqDB search
MTIENDIKRPSNDAITLENGKALNFRKKIPSPHERMYCNGSLDKWRLFISHISERCDLSG
LAKACTKYQLALTGFSDVDTHRERQTVTVDVPEEVNTALRDRYIRQGGSLRSIVLFAVHQ
MLRGFGNGSHTVTASISPDSEHRLSWEVSPTIVSHKNRGQTSVLEAIRNIDISNQRLQSS
KDEEIEEETQPNRASRFEEVGSELEGGWMKSELFDLPVVFVKARLDHVMRLSSIDVDFPL
AVLVHEGHNDGDLQLAVQFSTALFAPETIQNFTDALKNLLAEASTGPGTLVKDIDLLSAQ
QIQQLDVWNNTDGDYESSKRLNHLVEDAARHCPDKVAVVCEERELTYGDLNRQANSLARY
LCRFVQPEQLIGLFLEKNELLIITILAIWKSGAAYVPIDPAFPDDRVRFVLDDTKANLLI
ASDAHAARLQKNITSNKDIQVIRLELLLKELTSSAAGEFHDGQNLDHLPLNSRQLAYVTY
TSGTTGFPKGIFKEHTSVVNSITDLSVKYGVAGSHHETILLFSAYVFEPFVRQLLMALVN
GHLLAIISDVKKYDSDYLLSLIQRHQVTYLNGTASVLQEYDFSTCPSLKRIILVGENLTA
ARYDSLRQRFKGTILNEYGFTESAFVSALNIFEPHSKRENTSLGRPVRNVKCYILSQELK
RTPIGVTGELHIGGLGISRGYLNRPDLTPFKFIPNPFQTRREKELGINRLMYKTGDLARW
LPNGEVEYLGRADFQIKLRGIRIEPGEIESTLSMYPNIRTSLVVSRKLRSRGEETANEHL
VGYYVCQDNVEVVPEESLLAFLETKLPRYMVPSRLVHLEYIPVNINGKADLKALPVVDLS
RPAKGALNNLGHQTEIDLQKIWSDVLGVGNDSISPEDSFFRLGGHSISCIQLIARIRQQF
SVSISVEDIFAMKTLSRMAAFLRKKQSEIEASCTTDIATLSSASLSFPVLSGSNSTCYLA
NSLQQGFIYHYLKNKEPSGTYIMQSLLRYDTELRPDVFQKAWKLTQHAFPALRLRFLWEK
DVFQIIDQDQPLNFRFFSSDRDLEGLSSEDKLQNLQKQDLREDYKLDAGELFRVYMIKHD
DQHFSSLFSCHHAILDGWSLPLLFQHVHEEYLRLIKGGHFHFDTPIDKAYGHSQNFLQMN
RDTHLEYWSGVVEQITERCDMNVLLNEQSRYKIPLANYDQVRDQRQQTLHLDGDMHLRNI
HDACSERGITLHSILQFIWHTILHKYGGGSHTVTGTTISGRNLPVEGIEHSVGLYINTLP
LVLDHTEYKNKSVLDAMSDVQAKVNAMNTRGHVELGRLYKSNLKHGLFDTLFVFESYPAL
DRVKELQHQEALHYSIQGNMEKLNYPLTAIVQDINTAAIDTLTFTICYASELFDTPTILE
LLSMVQDTIKQISSNLTRPANSLEYLSLAQVNQLAEWNATEADFPDATLHQQFELEVDRV
PSKTAIIYEDVTLTYHELNERANRMAWQLKREVGIKPDDLVALVLDKSEHMMVSILAVWK
SGGAYVPIDPSYPEDRISYILQDTNAVTVIADPIYIPKVEKLTRPGVPIYPSDLATHNTS
DWSSDNPPPSSISTSLAYIFYTSGTTGRPKGVMVEHHGVVNLQTSLSRIFGLRETDDEVI
FSFSNYVFDHFVEQMTDALLNGQTLLILNDTMRGDKERLYQYMEKNRVTYLSGTPSVISM
YEFSRFKAHLRRVDCIGEAFSEPVFDRIRETFQGLIINGYGPTEVSITTHKRLYPFPERR
TDKSIGCQIANSTSYVLDEDMKRVPIGAVGELYLGGDGVARGYHNRPDLTADRFPLNPFQ
TDKEKSEGRNMRLYKTGDLVRWIPGSRGEVEYLGRNDFQVKIRGVRIELGEVEAVLSSYP
EIKQSVVVPKKRAQGGQTFLVGYCVSGSTISSIDIKRFMQSRLPDYMVPSRLIFVTKLPV
TPSGKLDTKALPAVDESADNEVVAPRTEIERTLREIWTELLEIPLEDISIYSDFFGLGGD
SLKSTRLSFMVNECLHRTISVAELFQHRTIEALGRLIVNGIGDIQDIALITDTNKDLSIS
PAQERVLFLHELEGGNSKGYNITKTLQLSSQTSPSLIEQALRELLSRHEALRTLLQKDAV
SGIYHQKILNNNEAQSLFFINTSTVRDLDHLDQKISDASQHIFHLGEELPLRVYMFTGNG
VSLYLTFVIHHSNFDGWSWNIVFRELVMLYSRLRGKDSITLPNLTVQYKEFAHHHRHILI
GDRFRVLSEFWRSKLENFEPLHLNTDKSRPPHFEYDGDDVNFIIGEQEIKELQKVAKQCK
ASLYAVLLALYGLMLASYTHQTNIPVGVPVTHRTHPQFESVVGFFVNLLVVRVDVTRQGI
VGLVKRVMQELVDAQLHQDMPFQEVTKLLNTEHDPSRHPLVQTVFNYESNQADTLRTKEN
KGGFAEYQPKQTYSAAKFDLSATVSEMGSKVMVNFNYAISLFTKSTIMGMLDTYRHLIYG
VCRLTEHGINDTTQLPLTPTCQGDGSHLPLLETQLAIHRDKEPAATLNKLFEAEVALASD
CVAIVEGEKTITYGDLNAQANQLAWYLLSITDLKPDDHVALMLDKSISMLICIFAVWKAG
AAYLPLDPTFPDNRIGTILQESKPKAVLLHSKYAARFESQGISLVTIDTTENISRQSTDD
VKSNVQPENLAYSMFTSGTTGKPKGVSVKQNGVINLRNGLRMRYFGNCAPGNHSVLFLSN
YIFDFSLEQIALSILSGQTLIIPPEHSFASNEFYDICNSYKLSYLSGTPSLLQQIDLRKL
KFLKMVTAAGEELHASQYKKMRDSFHGTIHNAYGITETTVYNLITAFSANDGFENCLREV
LPGNRIYLLGHNLQPVPLNAVGQLYLTGDCLARGYLNQPTLTTQRFIPNPFRTDEDAASG
KFSHLYKTGDLARCRLDSSGNPYIEYMGRNDLQVKLRGLRIELSEVQRVMSSVPGVEDCA
VIAKYMDDNPRSRVAQYLVGYYSTENPSGLEEIIIRHMKTKLPGYMIPEHLCHLRGPFPV
TRTGKLDIQKLPDIDVTTGPQAVYSPPHNALQSKLCALWASVLGVERCGIDDDLFKMGGD
SITSLHLVAQIHHRLSCKVTVRDLFEHRTIRKLYNNVLRNDLSGPTSEFRTEQGLVTGEA
PLLPIQEWFLSKPLEKRDQWNHTFYIQTPELDVDRLSVAVQKLQDYHDAFRMRLKQKGET
FVLSFPTEYQKIALRLLDVSSICERAAVNEALSEWQSGFNIENGPIGIIGYLYGYSDKTA
RVWFSIHHLAIDTVSWQILIRDLRNLYLDENLGSKGSSLRLWANSMSSYQGSKLEREYWD
NLIAQSSESVAALPPSTGPRLKLGRVMGADKSASLLQHAGQMEASVLAAVGLALQDVEPM
CCNMVTLEGHGREEDIDSTLDVSRTMGWFTSMYPFQIPHVKEADMLAAVAEIKTEVDRVP
CHGAGYGALYGYVRHPLPSVSVNYLGQLTRTPHMPNDYWNLAIGDGEYAYGLTCSPEDAK
KSSSAIDITVTCIDGRVAVDVFSIWDQDKSEVLISTIERGLDHIAEQLSSGSTSSTESPS
CQLFTEETFTPYFEYRDPSHRQGPTLFLLPPGEGGAESYFNNIVKYLPKHNLVAFNNFYL
HSKALQTFEELAEWYTDHIRRLQPQGPYHLLGWSFGGILAMEISRRLDDSSGKAISSLLF
IDTYFDVRGATEEIGMAEKTILDKIHHVYDPEPARLAHMLSRVKDVVLFKAAKPNDKYTS
DEQRLLYEYYHRTRANNLDKFIPIEHVSVMPLQGNTHFSWVWDVEQVKKVCSVIENILDN
MENGHI
NT seq 11361 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaaaacgacatcaaacgaccaagcaatgatgctatcaccttggaaaatggc
aaagctctgaattttcgaaagaagataccttcgccccatgagaggatgtactgcaatggg
agcctcgataaatggaggctctttatcagccatattagtgaacgctgtgatcttagtggc
cttgcaaaggcctgcactaaataccagctagcactaacagggttttccgacgttgatacc
catcgggagcgtcaaactgtaaccgttgatgtccccgaggaggttaacactgccctcagg
gacagatatatccgccagggaggctctcttcggagcatcgtgctgtttgcagtgcatcag
atgcttagggggttcggcaatggatcccacacagtcactgcttccatcagcccagattcg
gaacaccggctttcttgggaggtatcccctaccattgtctctcacaaaaatcgcggacaa
acgtcagtcctcgaggccatcagaaatatcgacatcagcaatcagcggctacagtcttcc
aaagacgaggaaatcgaagaagaaacacagccgaatcgggcatcgaggttcgaggaagtc
ggtagtgaactggagggaggctggatgaagtcggagctcttcgacttgccggttgtcttc
gttaaggcgcgcttagatcacgtgatgcggctctccagcatcgacgtcgatttcccacta
gccgtgctcgtccatgaagggcacaacgatggagacctccagctggctgtccagttttct
acagcactctttgctcctgagacgatacaaaattttaccgatgcgctgaaaaacctgctc
gcggaggcctcgacgggcccggggaccctagtcaaggacatcgacctgctctcggcgcag
caaattcagcaactggatgtttggaacaataccgatggcgattacgagtcttctaagcgc
ctcaaccatcttgtagaagatgctgcacgacactgcccggacaaagtagctgttgtgtgc
gaagagcgcgagctcacatatggcgacctcaaccgccaagcgaactctctcgccagatat
ctctgccgcttcgtgcagccagagcaactcatcggcctatttctcgagaagaacgagctg
cttataatcacaatcctcgcgatttggaagtcgggagctgcttatgttccaatcgaccct
gctttccccgatgaccgcgtccgttttgttctggatgatacaaaggctaatctcctcatc
gccagcgatgcacatgctgcaagattgcaaaaaaacattaccagcaataaagatattcaa
gtaatcaggcttgagctacttctgaaagagttaacatcttcggcggccggtgagttccat
gatggacaaaatctggaccacctgcctcttaacagcaggcagcttgcatacgtgacatat
acctctggcactaccggcttcccaaaaggcatattcaaagaacatactagtgtggtgaat
agtatcacggatttgtctgtcaagtacggtgtggcagggtcgcatcatgagacgattttg
ctattttctgcttatgtatttgagccgtttgtccgccaactgctcatggcgttggtgaac
ggccatcttctcgccattataagtgacgtgaaaaaatatgattccgactacctgctatcc
ctcatacagcggcaccaggttacctacctcaacggcaccgcttctgtgttgcaggagtac
gacttctccacatgtccatcattgaagcgcataatcctcgttggtgagaatctgacggct
gcacgatatgactcacttcgccagagatttaagggaacaattttgaacgaatatggattt
accgagtcagcctttgtgtctgccttgaacatatttgagcctcattccaaacgagaaaat
accagtctcggacgcccggttaggaatgtaaagtgttatattctcagccaggagctaaag
cgaactcctattggagtaacgggtgaattgcacatcggtgggttgggtatttcacgaggg
tatttgaatcgccccgacctgaccccgttcaaatttattcccaatcctttccagacgaga
agagagaaagagctcggtattaatcgcttaatgtacaaaactggtgacttggccagatgg
ctacccaacggtgaggtggaatatcttggacgtgcagatttccagatcaaattacgcggc
atccgaatcgagccgggagagatcgaatcgacgctttctatgtatcccaatattcgaaca
agcctagtagtgtccagaaaactcagatcaagaggtgaagagactgccaatgaacattta
gtagggtactatgtgtgccaagataatgtggaagtggttcctgaggagagtctgttggca
tttctagaaacaaagctacccagatacatggtcccatcacgtctggtccacctcgaatat
attcctgtgaatattaacggtaaagctgacctgaaagccttacccgtggttgatttatca
agaccagctaagggtgccttaaataatttgggacaccaaacggaaattgacctacaaaag
atttggagtgatgttctcggtgtcggaaatgattccatatcgcccgaggatagtttcttt
cgcttaggagggcatagtatcagttgtattcagctgattgcacggatccgacaacagttt
tctgtcagcatttctgtggaggacatctttgcaatgaaaacccttagccgcatggctgca
ttcctacgcaagaagcagagcgaaatcgaggctagctgtacaactgatattgctacacta
tcaagcgcctctttaagttttcctgtcctttcggggagtaacagcacttgttaccttgcc
aatagtcttcagcaaggttttatataccactacctaaaaaataaggagccttctggaaca
tacattatgcaatctcttttgcggtatgatactgaattgcggcccgatgtttttcagaag
gcctggaaacttacgcaacatgcatttccagcactgaggctccgatttttgtgggagaag
gatgtatttcaaattattgaccaagatcagcctcttaatttccgattcttctcttctgat
agggatctggagggcttatctagcgaggataagcttcagaatctacaaaaacaagatcta
cgggaagattacaagctagatgctggggaactctttcgggtgtacatgataaagcatgat
gaccaacatttctcctccctctttagctgccatcatgctattctcgatgggtggagcctg
cctttactcttccagcatgtccatgaggagtatctccgccttatcaaaggcggccacttt
cattttgatacccctattgataaagcgtacggacacagtcagaactttcttcaaatgaat
cgtgatactcaccttgaatactggtctggtgtagttgaacaaatcacggaacgctgcgat
atgaatgtccttctgaatgagcagagtagatacaagatacctctcgcaaactacgatcag
gtccgagatcagcgccagcagaccttacatcttgatggcgatatgcacctgagaaatatc
catgatgcatgctctgagcggggaatcactttacactctatccttcagttcatctggcac
accattctccacaagtatggtggcggaagccatacggttacgggaacaacaatctctggc
cgcaatctacctgtcgaaggcattgaacactctgtcggactctatataaacaccctgccc
ttagtgctagatcacactgagtacaaaaataagagcgtcctggatgcaatgtctgatgtt
caggccaaggtcaacgcgatgaatacacgggggcatgttgagctgggccgtttgtataaa
agtaacctgaaacacggactctttgacactctgtttgtctttgaaagctatccagccttg
gatagggtgaaagaactccagcatcaagaagctttacactattccattcaaggaaatatg
gaaaaattgaactatcctctcacagctatagttcaggatatcaacactgctgccatagac
acgcttacatttactatctgctatgccagtgaactttttgatacacccacgatcctagag
ttattgtcaatggtacaagataccattaagcagatatcaagcaaccttacccgaccagcc
aatagcttggagtatctctctttagctcaggtcaatcaattggctgaatggaatgcaact
gaagccgacttcccagatgcaactcttcatcagcagttcgagttggaggtagacagggtt
cctagtaaaactgctatcatctatgaggacgtaacgttaacataccatgaattgaacgag
agagcgaatcggatggcctggcaattgaagagggaagttggcataaaacccgatgaccta
gtcgctctcgttctggataaaagcgaacacatgatggtttctatactggcagtgtggaag
tctggtggagcttatgtaccgatcgacccgtcataccccgaagaccgcatttcttatatc
ctccaggacactaacgcggttactgtgattgccgaccccatctatatccccaaggttgag
aaacttacacggccaggagtaccgatatatccatcagatttggctacacataacaccagc
gattggagctcagataaccctcccccttcaagcataagcacgagcttagcctacatcttc
tatacatctggaacgactggccggccaaaaggggtaatggtagaacatcacggagtggtc
aatctacagacttcgctctccaggatctttggcctccgtgagactgatgacgaggttatc
ttctccttctcgaactatgtttttgatcattttgtagagcagatgaccgatgccttgctg
aatggccagactctattaatcctgaacgataccatgcgtggagataaagaaagactatat
caatacatggagaaaaatagggtaacttacttgtctggaaccccgtcagttatatccatg
tatgaatttagccggttcaaagcgcacttgagacgagtcgattgcattggtgaggcgttt
agcgaaccagtttttgatcggattcgcgaaaccttccaagggcttatcatcaatggctac
ggtcccactgaagtctctattactacccacaaacgtctatatcctttcccggagcgccgc
actgataagagtatcggctgtcagatagccaacagcaccagctatgttctcgatgaagac
atgaagcgcgtcccaatcggggccgttggagagctctacttaggtggtgatggagttgcc
cgaggttatcataatcgccctgaccttacagccgatcgatttcctctcaatccattccaa
acagacaaagagaaaagtgaggggcgtaacatgcgactctataagaccggggatctcgtg
cgttggattcctggcagtagaggagaagttgaatacttgggccgcaatgactttcaagta
aagatccgtggagtgcgaattgaactcggcgaagtcgaagccgttctgtcttcgtaccca
gaaatcaagcagtccgtagttgttcctaaaaaacgtgcgcaggggggccaaacattcctc
gttggatactgtgtttctggttcaacaatatcttcgatagatataaaacgatttatgcag
tctcgtctgccagactacatggttccctctcggctcatcttcgtcacaaagttacctgtt
acccctagtggcaaactagacacaaaagctctgccagccgttgatgagtcggcagataac
gaagtagttgcaccacggactgaaatcgaacgaactttgcgtgaaatatggacggagtta
cttgaaataccgctagaggatatcagcatctacagcgatttctttggcctcggaggcgat
agtttgaagagtaccagattatccttcatggtcaatgaatgtcttcacaggacaattagc
gttgccgagcttttccagcatcgaacaatcgaagcattaggtcgtttaatcgttaacggc
atcggggacatacaggacatcgccttgatcactgacacaaacaaggatctctcaatatcc
ccggcgcaagagcgtgttctatttctccacgagcttgaaggcgggaatagtaaagggtac
aatatcacaaaaacattacaattgtcctcccagactagcccttctctaatagaacaggcg
ctaagggaacttctatcacgacatgaggcattacgtactttgctgcagaaggacgctgtc
tctggaatctaccatcagaagattttgaataataatgaagcgcagtctttgttcttcatc
aatacatctacagtcagggatttggatcatctcgatcagaaaatttctgacgcttcccaa
catatattccatttgggagaggaactacccctcagggtgtatatgttcacggggaatggt
gtctcattatatctcacgtttgtcattcaccactcgaactttgatggttggtcttggaat
attgtcttccgggaacttgttatgctttattctcgtttgcggggcaaagactctatcaca
cttccaaatctcacagttcaatataaggagttcgcacatcatcatcgtcatatacttata
ggcgaccgttttcgtgtactctccgagttctggcgaagtaagcttgagaacttcgagccc
cttcacctcaatactgataaatctcggccgccccattttgaatatgatggagatgatgtg
aactttattataggcgaacaggaaatcaaagagttgcaaaaggtggcaaagcaatgcaaa
gcaagtctctacgctgttctccttgcattatacggtctgatgctcgcttcctatacccat
caaactaatattccggtcggtgtgcctgtcacccatcgaacccacccacagttcgaatct
gtggttggttttttcgtcaatcttcttgttgtacgagtggatgtgacccgtcaaggaatt
gttggacttgttaaacgggtaatgcaggagctggtggatgctcaacttcatcaagacatg
ccgttccaggaggtaacaaaacttctgaatacagaacatgaccccagtcgacatcctcta
gtacaaactgtattcaattatgaatcaaaccaggctgataccctgcgaacaaaagagaac
aaaggaggtttcgctgaataccaaccaaaacagacatactcagctgcaaaatttgacttg
agcgctacagtttctgaaatgggatccaaggtgatggtcaactttaactacgctatcagt
ctattcaccaaatccacaattatgggaatgttggatacatataggcatcttatctatggg
gtttgtcgtttaaccgaacacgggattaacgacaccacgcaactcccattgacgcccaca
tgtcagggtgatggcagtcacttgccattgctggagacacagcttgccatccacagggac
aaggagcctgctgctaccttgaacaagctgtttgaagccgaagttgctctggcgtcagac
tgtgtcgcgatcgtcgaaggagagaaaaccatcacatatggcgatctcaatgcccaagct
aaccaattggcatggtatttactttcaataacagacttgaaaccagatgaccatgtagct
ctgatgctggacaagagtatcagcatgctcatttgtatttttgctgtttggaaagctgga
gccgcatatttaccccttgatcctacgtttcctgataaccgaataggcacaattcttcag
gaatctaagccaaaagctgttcttttgcatagcaaatacgcagcacggttcgagtcccaa
ggtataagcctcgtcacgatagatactacggagaacatcagccgccaatcgacagatgat
gtcaaatcaaatgtgcagcctgaaaatctggcatatagtatgttcacatcaggaactact
ggcaaacctaaaggtgtatcagtcaagcaaaatggagttatcaatcttcggaacggcctt
cgaatgcgatattttggcaactgtgcgccaggaaaccatagtgtgctatttctctccaac
tacatctttgacttctccctcgaacaaatagcgttatcaatcttaagtggccagacactg
atcatcccgccagaacattctttcgccagcaacgagttctatgatatctgcaattcatat
aaactctcttatttgagcggaactccgtctcttttgcaacaaatcgatctacgaaaacta
aagtttctgaaaatggtaacagctgctggtgaagagctccatgcctctcagtacaagaag
atgcgtgatagcttccacggtactattcacaacgcttatggaatcactgaaacaacagtg
tacaatctcattactgccttttcagccaatgatgggtttgaaaactgtctacgagaagtc
ttacctggaaatcggatttacctactcggccataatcttcagcctgttccgctaaatgca
gtaggacaactatacctgacaggtgactgtctcgctcgtgggtacctcaaccagcccaca
ttaaccacacagcggtttatccctaaccccttccgcactgatgaggacgctgcctctgga
aaattctctcacttgtataagactggagacctagctaggtgcaggctggatagctcaggg
aatccttatatcgaatacatggggcgaaatgacctccaagtcaagcttcgaggtctccga
attgagctttccgaagttcagcgagttatgtcctcagttcctggggttgaagactgcgct
gtcatcgcgaaatatatggatgacaacccacgctctcgtgtggctcagtatcttgtggga
tactactccacggaaaatccatcaggccttgaggaaataatcatcagacatatgaaaacc
aagcttcccgggtatatgataccagagcatctgtgccatctcagaggcccctttcccgtt
actagaacagggaaacttgatatccaaaagctaccagatatagacgtcacgaccggtcct
caggccgtgtattcaccgccacacaatgccctgcaatccaaactttgtgctctctgggcc
tctgtcttgggggtggaacggtgtggaattgacgatgacctgttcaaaatgggtggggac
agcatcacctcccttcatctggtcgcacaaatccatcatcgtcttagttgcaaagtcacc
gttcgtgacttattcgaacatcgcaccatccggaagctatacaataatgttctacgtaat
gacctgtcaggccccaccagcgagttccgcactgagcaaggtcttgtcaccggtgaggca
cccctactgccaattcaagaatggttcctttccaagccgctagagaaacgggatcagtgg
aaccatacattctacattcaaacgccagaattggatgtggatcgtttgtcagttgctgta
cagaagttacaggactatcacgatgcattccgtatgcgattgaagcaaaagggggagact
ttcgttctatcattcccaacagagtatcagaaaattgcactccgcctcttggatgtaagc
agcatttgtgaacgtgctgctgtcaatgaggccctcagcgagtggcagtcggggttcaat
attgagaatggccctatcggtattatcggctacttgtatggatacagtgataaaacagcc
cgtgtatggttctcaatccatcatcttgccatcgatacggttagctggcagattttgata
cgcgatcttcggaatttatatcttgatgaaaatttaggcagcaagggcagcagtcttcgg
ctatgggctaacagtatgagcagctatcagggctcaaaactggagcgagaatactgggat
aacttgatcgctcaaagttccgaaagtgttgcagcactccccccttctactggacctcgt
ctaaaattagggcgcgtcatgggtgctgacaagtcagcatctctgctgcagcacgctggc
caaatggaagcatctgtgcttgctgcagtcgggctagcgctccaggatgttgagccaatg
tgctgtaatatggtcaccttggaaggacatggtcgtgaagaagatatcgatagcactctg
gatgttagccgtacgatgggctggttcacaagcatgtatccatttcagattccccatgtg
aaggaggccgacatgcttgcagcagtagccgaaataaaaacggaggtggaccgagttcct
tgccatggcgctggatatggtgcgctctatggctatgtacggcatccattacccagtgtc
agcgtcaattatctagggcagcttacgcgaacgccacatatgcccaatgattactggaat
ttagctattggggatggagaatacgcgtacgggctgacgtgcagccctgaggacgcaaaa
aagagctcttccgctatagacataacggtgacatgcatcgatgggagagtggctgttgac
gttttcagtatctgggaccaagacaagagtgaggtgttgatatctacgattgagcgcgga
ctggaccatatcgccgagcagctcagcagtgggagtacatcttcaaccgagtctccatcc
tgccagttatttaccgaagaaacattcacgccttactttgaatatcgtgaccctagccat
cgacaaggtccgaccctgtttctcctgcctccaggcgaaggcggagccgagagctacttc
aacaacattgtcaaataccttccaaagcacaatctggtggctttcaacaatttctaccta
cacagtaaggctctacagacatttgaggagctggcggagtggtatacagaccatatacgg
cgtctccagcctcagggaccgtaccatttacttggctggagttttggtggcatcctcgca
atggagatttcccgccggctggatgatagcagtgggaaggcgattagctcacttctattc
attgacacctacttcgacgtccggggcgcaaccgaggagatcgggatggctgagaagaca
atcctggacaaaatccatcatgtatacgatcctgaacccgcgcggcttgcacatatgctc
tcccgagttaaggatgttgttctcttcaaggctgccaaacctaacgacaaatataccagc
gacgagcagcgtctattatacgagtactatcataggaccagagccaacaacttggacaaa
ttcatccctatcgagcatgtctcggtaatgccgttgcaaggtaatactcatttttcctgg
gtctgggatgttgagcaggtgaagaaagtatgcagcgtgattgaaaacatactggataac
atggagaacgggcatatttag

DBGET integrated database retrieval system