KEGG   Arthroderma benhamiae: ARB_02294Help
Entry
ARB_02294         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abe  Arthroderma benhamiae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_02294
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_02294
   00620 Pyruvate metabolism
    ARB_02294
   00640 Propanoate metabolism
    ARB_02294
  Energy metabolism
   00680 Methane metabolism
    ARB_02294
Enzymes [BR:abe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ARB_02294
Lipid biosynthesis proteins [BR:abe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ARB_02294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 667 aa AA seqDB search
MAEVDAAKAPVVVEAHQVETVGVPAEYHQHSTKTHLKSFEEYKTLYEESIASPDTFWARL
ARELVTFDKDFNTTHIGSLKGGDNAWFVGGRLNASYNCVDRHALKNPDKVAIIYEADEPG
EGRSITYGELLKQVSSFAWTLKQQGVKKGDTVAIYLPMIPEALVAFLACSRIGAVHSVVF
AGFSSDSLRDRINDANSKVVITSDEGKRGGKLIGTKKIVDEALKQCPGVTSCIVFKRTGA
EVPWTQGRDLWWHEEVEKYPSYIAPESMDSEDPLFLLYTSGSTGKPKGLMHTTAGYLVGA
AATGKYVFDIHEEDRFFCGGDVGWITGHTYVVYAPLLLGATTVVFESTPAYPNFSRYWDV
IEKNKVTQFYVAPTALRLLKRAGDQHIHHEMKDLRVLGSVGEPIAAEIWKWYYEVVGKKK
AQVVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIVDPVTGEELKGNDVEGVL
AFKQPWPSMARTVWGAHKRYMDTYFNVYPGFYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIEAALITHSSVAEAAVVGVHDELTGQAVNAFVALKTGNEIGEEIRKELVMQVR
KSIGPFAAPKAVYVVEDLPKTRSGKIMRRILRKILSGEADSLGDISTLSDPTVVPKIIEM
YEATKKK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtagacgccgctaaggccccggtggtcgtggaagcccaccaggtcgagacc
gttggtgtacctgcggagtaccaccagcactccaccaaaacgcacttgaagagctttgag
gaatacaagactctttatgaggagtctatcgcgagtccagataccttctgggcgcggctg
gcgcgggaattagtgacctttgacaaagacttcaacacgacgcacatcggctccttaaag
ggaggtgataatgcttggtttgttggtgggagactgaatgcttcttacaactgtgtcgac
cgccatgcgctcaagaatccggataaggttgctatcatctacgaggccgatgaacctggc
gaagggcgcagcatcacttacggcgagctgctcaagcaagtctcgagcttcgcatggact
ttgaagcagcagggggtgaagaagggtgatacggtggctatctatttgcctatgattcca
gaggctctggttgctttccttgcttgttctcgcattggtgctgtgcactctgtcgtcttt
gcgggcttctcgtccgactcgctgcgtgatcgtatcaatgacgccaactccaaggttgtc
attacctctgacgagggcaagcgaggcggaaaactcattggaaccaagaagattgtcgac
gaggctttgaagcagtgtcctggagtgactagctgcatcgtgttcaagaggactggagca
gaggttccatggactcaaggacgcgatctctggtggcacgaggaggttgagaagtacccc
agctacattgctcctgagtccatggattcggaagatcctctgttcctcttgtatacttca
ggctcaaccggaaagcccaagggactgatgcacaccactgctggttacctggttggcgcc
gctgcaactggtaaatacgtctttgatatccacgaggaagaccgattcttctgcggtggc
gacgttggttggattaccggacatacctatgttgtctatgctccactacttctcggtgcg
accacagtcgttttcgagagtactcctgcctatccgaacttctcgagatactgggacgtc
attgaaaagaacaaggtcacgcagttctacgttgcaccaaccgcactcagacttctcaag
cgtgccggtgaccagcatatccaccacgagatgaaggatctccgagtgttgggaagtgtt
ggtgagccaatcgcagctgagatctggaaatggtactatgaagttgttggcaagaagaag
gcccaagttgtcgacacatactggcaaaccgagactggctctcacgtcattactcccctg
ggtggaatcactcctaccaaaccgggaagtgcttctctgccattcttcggcattgagcct
gccatcgtcgacccagttaccggtgaagaactgaagggtaacgatgtagagggtgtgttg
gcatttaaacagccgtggccaagcatggctcgcacagtatggggtgcccacaagcgatac
atggacacctacttcaatgtctacccaggattctacttcactggagacggtgctggccga
gaccatgacggatactactggatcagaggaagagttgacgacgttgtgaacgtctccggt
catcgtctttctactgccgaaatagaagctgctctcatcacacactcttccgttgccgag
gctgccgtcgtcggtgtacacgatgagctcaccggccaggcagtcaacgccttcgttgcc
ctcaagacaggcaacgaaatcggtgaggagatccgcaaggagttagtaatgcaggttcga
aaatctatcggaccctttgcggctcctaaggcggtctacgtcgttgaagacctgcccaag
actcgcagcggaaagatcatgcgacgtattctcaggaagatcttgagcggcgaagccgac
agcttgggtgatatctcgacgctttcggatccaaccgtggttcccaagattatcgagatg
tatgaggcaacaaagaaaaaatga

DBGET integrated database retrieval system