KEGG   Arthroderma benhamiae: ARB_02307Help
Entry
ARB_02307         CDS       T01611                                 

Definition
histone acetyltransferase, putative
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
abe  Arthroderma benhamiae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1088 aa AA seqDB search
MAATPLAAYDNNYPEQEPEIDSEQDAEGDEDPEFYDATAQAGIVTTYENSTVTVDGTYHG
KGETDEGGAVDENNVNHEKEPSLIDDDSKEKVDQDAAVIGSASEDGKSASEADELDAEFE
ELSNESNAVASEASSESDSEAEEEWEAESNEQEDADTEPPVENNCIVCKEDEEHDPSEVF
EEPLICDTCSVHYAGKWKCPLCKHLHSQPDTRNSSTARQKSTVSSVTKDLLPADNDTQDP
NSHSVFNSLIIEDDPLDGSRSLRKRKSSSYEAENRRSTTRKRRKVTPPHGQALPTTRASG
SRSRAPSQNQLAENDVTTVHENRAPRQRRTRNAQKYYCSIVQKQEGRLILSFNLDQEKIQ
KILNSKPRPRSQRRRPLPKPPTIPEPPPVSHFAPTNPTPYAAPFYSFHDRENDELKSKPY
GGILSEAEADTSRTVPLSTDRDKFEAARQKAEEEWRKKMMANEEDSDNALLSSQKLSGPP
SKIKYINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDFVAWRHKLKCPAKHPP
GDEIYREGSVSIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEYDEWGC
HFVGYFSKEKRPSSSNNVSCILTLPIHQRKGYGNLLIDFSYLLTRLEGRTGSPEKPLSDM
GLVSYRNYWRLVLCYKFRDKKSPTSITAISEQTGMTPDDVISALEGLSALVRDPVTKTYA
LRLDYDFFERYIESWEKKGYVKLNPNSLVWTPYIMGRSNKSHYDHAPIHTVAPREEIDAD
EPTAATNSIPTNSYGLGISASDADTANSVAGSGVETVNTNGKGFSEASPSLFDAPGPPST
SALSFADVMAKQAPSTNGRQSSSTPSNPAFGIPPTRFEIFPPPQGASTSTPTVKRRPGRP
FGTRKKVRSTAQSPARTSGHSTPKKSKPLRLGTPSTATRPLRFSVRRARSSMLGDNPDTK
HDTDPESPGGTKRFDYPNSFPSTSNGPTDQPEANGSPETDKNDEETHINKIPESMEIDRQ
LLNGIEDHTRNHQPQLVDGTNKNETELTNGLTKPMDDTSQSIATQVDNPGENGASDAPSE
KKIPLQCS
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaccccactggccgcttacgataacaactatcccgaacaagaaccagaaata
gatagcgaacaagacgctgaaggggacgaggaccctgagttttatgatgcgactgcgcag
gctgggatagtcacgacgtatgaaaactcgactgtgacggttgatgggacataccatgga
aaaggggaaactgatgaaggaggtgctgtggacgaaaataatgtcaaccacgaaaaggaa
cccagccttatagatgatgattctaaggagaaggtggatcaggatgctgcagttatagga
agtgctagcgaggatggcaaatcggcgagtgaagcagatgaactggatgctgaattcgaa
gagctttcaaatgagagtaatgcagttgccagcgaagcgtcctctgaatctgactccgaa
gctgaagaggaatgggaagctgaaagcaacgaacaagaggatgctgatacagaaccccct
gttgagaacaattgcattgtttgtaaagaggatgaagagcacgatccaagtgaggtcttt
gaagagccattaatatgcgacacatgtagtgttcattatgccggtaaatggaagtgtccg
ttatgtaaacatttgcactcccaaccggacacaaggaactcctccaccgctcgacaaaaa
tctactgtctctagtgttacgaaagatctgctccctgcggacaatgatacccaagatcca
aattctcattccgtatttaactcattaatcatcgaagacgatccattggatggctcccgc
tctttgcgaaaaaggaaatcatcatcctatgaggctgaaaatagacgctcgaccacacgg
aaacgacggaaagtcactcctccgcacggacaagcgttaccgacaacgagggccagcggg
agtcgctcgcgtgccccgagccagaaccaacttgcagaaaatgatgttacaactgtgcac
gaaaaccgagcacctcgccagaggagaacgagaaatgcccaaaagtattactgcagcatt
gtgcagaaacaagaagggcggttaatactgtcattcaatcttgaccaggaaaagattcaa
aagatactgaacagtaaaccaaggccgaggagccaacggcgaagaccattacctaaaccc
ccaactatacctgagcctccgccggtatcacactttgcaccgacaaacccaactccatat
gctgcacctttctactccttccacgaccgagaaaacgatgaactcaagtcaaagccttat
ggtggaattttatccgaggccgaagctgatacgtcgcgaactgtacctctgtcgacagat
agggataagtttgaggcagctcgtcaaaaggcagaagaagaatggcggaagaaaatgatg
gcaaatgaggaagactcggataatgctctcctctcttctcaaaagctgtctgggccacca
agcaaaatcaagtatatcaactttggcggttatgagattgagacttggtatgctgcacca
tatcctgaagaatacagtcgcaatcgggttttatacatttgcgaattttgcctcaagtat
atgaactccgatttcgttgcatggcgacataaactcaaatgccctgcaaagcatcctccg
ggcgatgagatctatcgggaagggtctgtttctatatttgaagtggacgggcggaaaaat
cccgtctattgccaaaatctctgtttactggccaagctctttctgggttcaaagacactc
tattatgacgtggaacctttcttattctacgtcatgacagaatatgatgaatggggctgt
cattttgttggatatttcagcaaagagaagcggccgagttcctcgaataatgtctcttgt
atcctgacccttccaatccaccagagaaagggttatggaaatctcctgattgatttctct
tatcttctcacccgactagaaggaagaacaggttctccggaaaaaccattatctgatatg
ggcctggtttcctatcgcaattactggcgtcttgttctatgttataagtttcgggataaa
aaatcaccgacaagcattacagcgatatccgaacagaccggtatgactcccgatgatgtt
atatccgcgttagaaggcctgagtgctctcgtccgtgatcctgtcactaagacttatgcg
ctccgcttggactacgatttttttgaaaggtacatagagtcttgggagaaaaagggctac
gtcaagttgaatcccaattctctggtgtggacgccgtatataatgggccgcagtaacaag
tcccactatgaccatgcgcccattcatactgttgctcctcgtgaagagattgatgccgat
gagccaactgcggcaaccaattccatacccaccaactcatatggcctcggcattagcgca
agcgacgctgatacagcaaacagcgttgcaggaagtggtgttgaaactgtcaataccaat
ggaaagggcttctctgaagcttcgccttcattgttcgacgctccaggaccgccttccacc
agcgctctgtcattcgctgatgtcatggccaaacaagctcctagcaccaatggtcgtcaa
tcgtcatctactccttcaaaccctgcttttggcattcccccaacgaggttcgagatcttt
cctccacctcaaggtgccagtaccagtactcctaccgttaagcgacgaccaggtcggcca
tttggaactcggaaaaaggttcgctccaccgcacaatctccagcaagaacgagtggacat
agtacgcccaaaaagagcaaacctttacgcctgggtactccttccacagcaacaagaccc
ctgcgcttcagcgttcgacgggcgagaagtagcatgctaggtgacaacccggacacaaaa
cacgacactgatcctgaaagtcccggcggaaccaagcggtttgactatcctaactcattt
ccatcgacatccaatggtcccactgatcaacccgaagcaaatggctcccctgaaactgat
aaaaatgacgaggagactcatatcaataaaataccagagtcgatggaaattgaccggcaa
ttgcttaatggtattgaagaccacacgcgcaatcaccaaccgcagctagttgatggtacg
aataagaacgaaactgaacttacgaatggtttaacgaagccgatggatgatacctctcaa
agtatcgccacacaggtggacaaccctggtgaaaacggagcttccgatgctccttcggaa
aaaaagattccactacaatgttcatga

DBGET integrated database retrieval system