KEGG   Trichophyton benhamiae: ARB_02410Help
Entry
ARB_02410         CDS       T01611                                 

Definition
(RefSeq) beta-glucosidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abe  Trichophyton benhamiae
Pathway
abe00520  Amino sugar and nucleotide sugar metabolism
abe00531  Glycosaminoglycan degradation
abe01100  Metabolic pathways
abe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARB_02410
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    ARB_02410
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ARB_02410
Enzymes [BR:abe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ARB_02410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Acetyltransf_7 Acetyltransf_1 Acetyltransf_10 Acetyltransf_9 Glyco_hydro_3_C Acetyltransf_CG FR47
Motif
Other DBs
NCBI-GeneID: 9524252
NCBI-ProteinID: XP_003011351
UniProt: D4B1S9
AA seq 885 aa AA seqDB search
MLDLPQLQSSSKQKTNSYIARRTGSDRAGIMNEEEEIRRSLGQLFIVGFDSLTASEDIKS
LIKAPFYIGNIILFRRNVHDSEQLITLTNELQQTARDAGHVRPLFIAADQENGWVSQIKP
PIATQFPGAMALGATGSIEDATQIGRATGEMLDALGINMNYAPVCDVNSEPSNPVIGIRS
PGDDGVSVGRIASAFATGLREKRIVPCAKHFPGHGDTTVDSHYGLPIVDKSIEELEACEL
IPFRRVTAENIESVMTSHIVLPALEESNLPMTLSKSCVDFLRERLQYDGLLVSDCLEMDA
IREYYGTEKGAAMAIAAGVDCAMVCHTLKVQVGAYNEVYQAFKQGDITSEGVAKSVARVA
ALKDKFISWKSVFRKRKPELLSELRLAHERLSTRIYARSTTLVRDTQKVIPLKPAENVVY
AYISLVGENVAVPHTLPHTQSKFWDVIKQYHSYTIECPVLQDIILEDDEMTKAKISEADA
VILVTKDAKMSVDQVELTKLIEGLSKKLIVVAIGGPYDFLEDEDFVKTYLTIYEPTVEAF
IPAVRIIFGDIDAKGKLPVSVKPCQVPIEPFNADRDLAKVVELWHGLLPRYAVPSATLSH
VLSRPNGNHFVSRVGDKVVGFVATYTNEDRPTAFIPVVLVDSGHQGKGVGTALIEHARIY
LRNGYSTSSVTIGSSFPRFWPGVPMDISNQAQEFFIHRGFCPERRPTARDYTVDLLSYEA
PKGVLERAEKAGVTYAPWRKEQYEECMEKQRKLFGKDPVWMDAYEGLAQTGQYNQVMVAT
DSSTGEQIGWTLMQELGIGMTQELAMQPLVGIKSGQIGCVGVVPEARNKGVGLALITHAA
LDLKRRGMEHVFVDWSNHVNWYERAGFKVWGEYRTMVLHELAKTN
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccttcctcagcttcaatcatcatcaaaacaaaaaacaaacagttacattgct
aggaggacagggtccgacagagccggcatcatgaacgaggaagaagaaatcagaagaagc
ctgggccagctcttcatcgtcggctttgatagcctgacagccagtgaagatatcaagtca
ctcatcaaagcacccttttacatcggaaatatcattctgttccgacgtaatgtccacgat
tcagagcagttgattactctcacgaatgagcttcagcaaaccgctcgggatgcgggtcat
gtccggcccctgttcattgccgcagaccaagagaacggttgggtcagccagattaagccg
cccatcgctactcagtttcctggagctatggctctgggagcaacgggctccatcgaagac
gctactcagatcggtagagctacgggtgaaatgctagatgcccttggtattaacatgaac
tatgctcctgtctgcgatgtaaactcagagccatccaacccggttatcggaattcggtct
ccaggagatgacggagtgagcgtgggacgaatagcttcggcttttgccacaggcttgcgt
gagaagaggattgttccatgtgcaaagcatttcccaggccatggagatacgacggtcgat
tcccattatggccttcccatcgtggacaaatccatcgaagaactggaagcatgtgaactg
attccgttccgaagagtgactgcggagaatatcgagtccgttatgacgtcccatattgtt
ctaccggcacttgaggagtcaaatctacccatgactctcagcaaaagctgcgtggacttc
ctgcgggaaagactccagtatgatggactgttggtgtctgactgcctggagatggatgct
attcgtgagtactatggcactgaaaagggcgctgctatggcaattgccgctggcgtagat
tgtgccatggtgtgtcatacactgaaagttcaagttggtgcgtataacgaagtctatcaa
gctttcaagcagggggatatcacctctgaaggtgttgccaaatcagtcgcaagagtcgca
gcattgaaagacaagtttattagctggaagtcagtcttcagaaaacggaaacccgagctg
ctttcagaacttcgtctggcacatgaaagactttcaacgagaatttatgctcgaagtaca
acattggtgagggatacacagaaagtcattcctctcaagccagctgagaacgtggtatat
gcatacatttctctagtcggagaaaacgttgcggtcccccatactcttccacacacccag
tcgaaattctgggacgtgatcaagcaataccactcatatacaattgaatgcccagttctc
caggacatcatacttgaagatgacgaaatgaccaaagcaaagatatcagaagctgatgca
gttattctggtaaccaaagatgcgaagatgtccgtagaccaggtagagctgacgaagctg
attgaggggttgtccaagaagctcattgtagtggctattggaggtccgtacgacttccta
gaggatgaggattttgtcaaaacctacctcaccatatatgagccaactgttgaagctttt
atacctgctgttagaataatatttggagacatcgacgcgaaaggaaaacttccagtgtcg
gttaaaccttgccaggtaccgattgagcctttcaacgcagacagggatcttgctaaagtc
gtcgaactttggcatggacttttaccaagatatgccgtaccatcggcgacactttcccac
gttctaagcaggccgaatggaaaccactttgtttcacgtgttggagataaagtagtagga
tttgtggccacttatacaaatgaagaccggcctacggcattcatccccgtggtccttgtg
gactccggccaccagggcaagggcgtgggaaccgcactgattgagcacgcccgaatatac
cttcgaaacggatattccacgtcatcagttacaattggttcaagcttccctcggttttgg
ccgggagtcccaatggatatttcaaatcaagcccaggagttctttatccatcgtgggttc
tgtcctgagcgtagaccaacagcaagggactacactgtcgacttactctcatacgaagca
ccaaagggcgtcttagagcgcgcagaaaaggcaggagtcacatatgctccctggagaaag
gaacaatatgaagaatgtatggagaaacagcgcaagctgtttggcaaagatcccgtgtgg
atggacgcttatgaagggctagcacaaacaggccagtacaaccaggtaatggtagcaacg
gactcatcgacaggtgagcagatcgggtggacattgatgcaggaattgggcatcgggatg
acacaggagctcgccatgcagccgctggtgggtatcaagtctggtcaaattggctgcgta
ggagttgttcctgaggcaagaaacaagggagtcggtctcgccctgatcacgcacgctgcc
cttgatctgaaacgacgagggatggagcatgtattcgtcgactggtcgaaccacgtcaac
tggtatgagcgtgctggcttcaaggtctggggcgagtatcggactatggtgttgcatgag
ctggcgaagactaactag

DBGET integrated database retrieval system