KEGG   Arthroderma benhamiae: ARB_02410Help
Entry
ARB_02410         CDS       T01611                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abe  Arthroderma benhamiae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARB_02410
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ARB_02410
Enzymes [BR:abe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ARB_02410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 885 aa AA seqDB search
MLDLPQLQSSSKQKTNSYIARRTGSDRAGIMNEEEEIRRSLGQLFIVGFDSLTASEDIKS
LIKAPFYIGNIILFRRNVHDSEQLITLTNELQQTARDAGHVRPLFIAADQENGWVSQIKP
PIATQFPGAMALGATGSIEDATQIGRATGEMLDALGINMNYAPVCDVNSEPSNPVIGIRS
PGDDGVSVGRIASAFATGLREKRIVPCAKHFPGHGDTTVDSHYGLPIVDKSIEELEACEL
IPFRRVTAENIESVMTSHIVLPALEESNLPMTLSKSCVDFLRERLQYDGLLVSDCLEMDA
IREYYGTEKGAAMAIAAGVDCAMVCHTLKVQVGAYNEVYQAFKQGDITSEGVAKSVARVA
ALKDKFISWKSVFRKRKPELLSELRLAHERLSTRIYARSTTLVRDTQKVIPLKPAENVVY
AYISLVGENVAVPHTLPHTQSKFWDVIKQYHSYTIECPVLQDIILEDDEMTKAKISEADA
VILVTKDAKMSVDQVELTKLIEGLSKKLIVVAIGGPYDFLEDEDFVKTYLTIYEPTVEAF
IPAVRIIFGDIDAKGKLPVSVKPCQVPIEPFNADRDLAKVVELWHGLLPRYAVPSATLSH
VLSRPNGNHFVSRVGDKVVGFVATYTNEDRPTAFIPVVLVDSGHQGKGVGTALIEHARIY
LRNGYSTSSVTIGSSFPRFWPGVPMDISNQAQEFFIHRGFCPERRPTARDYTVDLLSYEA
PKGVLERAEKAGVTYAPWRKEQYEECMEKQRKLFGKDPVWMDAYEGLAQTGQYNQVMVAT
DSSTGEQIGWTLMQELGIGMTQELAMQPLVGIKSGQIGCVGVVPEARNKGVGLALITHAA
LDLKRRGMEHVFVDWSNHVNWYERAGFKVWGEYRTMVLHELAKTN
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccttcctcagcttcaatcatcatcaaaacaaaaaacaaacagttacattgct
aggaggacagggtccgacagagccggcatcatgaacgaggaagaagaaatcagaagaagc
ctgggccagctcttcatcgtcggctttgatagcctgacagccagtgaagatatcaagtca
ctcatcaaagcacccttttacatcggaaatatcattctgttccgacgtaatgtccacgat
tcagagcagttgattactctcacgaatgagcttcagcaaaccgctcgggatgcgggtcat
gtccggcccctgttcattgccgcagaccaagagaacggttgggtcagccagattaagccg
cccatcgctactcagtttcctggagctatggctctgggagcaacgggctccatcgaagac
gctactcagatcggtagagctacgggtgaaatgctagatgcccttggtattaacatgaac
tatgctcctgtctgcgatgtaaactcagagccatccaacccggttatcggaattcggtct
ccaggagatgacggagtgagcgtgggacgaatagcttcggcttttgccacaggcttgcgt
gagaagaggattgttccatgtgcaaagcatttcccaggccatggagatacgacggtcgat
tcccattatggccttcccatcgtggacaaatccatcgaagaactggaagcatgtgaactg
attccgttccgaagagtgactgcggagaatatcgagtccgttatgacgtcccatattgtt
ctaccggcacttgaggagtcaaatctacccatgactctcagcaaaagctgcgtggacttc
ctgcgggaaagactccagtatgatggactgttggtgtctgactgcctggagatggatgct
attcgtgagtactatggcactgaaaagggcgctgctatggcaattgccgctggcgtagat
tgtgccatggtgtgtcatacactgaaagttcaagttggtgcgtataacgaagtctatcaa
gctttcaagcagggggatatcacctctgaaggtgttgccaaatcagtcgcaagagtcgca
gcattgaaagacaagtttattagctggaagtcagtcttcagaaaacggaaacccgagctg
ctttcagaacttcgtctggcacatgaaagactttcaacgagaatttatgctcgaagtaca
acattggtgagggatacacagaaagtcattcctctcaagccagctgagaacgtggtatat
gcatacatttctctagtcggagaaaacgttgcggtcccccatactcttccacacacccag
tcgaaattctgggacgtgatcaagcaataccactcatatacaattgaatgcccagttctc
caggacatcatacttgaagatgacgaaatgaccaaagcaaagatatcagaagctgatgca
gttattctggtaaccaaagatgcgaagatgtccgtagaccaggtagagctgacgaagctg
attgaggggttgtccaagaagctcattgtagtggctattggaggtccgtacgacttccta
gaggatgaggattttgtcaaaacctacctcaccatatatgagccaactgttgaagctttt
atacctgctgttagaataatatttggagacatcgacgcgaaaggaaaacttccagtgtcg
gttaaaccttgccaggtaccgattgagcctttcaacgcagacagggatcttgctaaagtc
gtcgaactttggcatggacttttaccaagatatgccgtaccatcggcgacactttcccac
gttctaagcaggccgaatggaaaccactttgtttcacgtgttggagataaagtagtagga
tttgtggccacttatacaaatgaagaccggcctacggcattcatccccgtggtccttgtg
gactccggccaccagggcaagggcgtgggaaccgcactgattgagcacgcccgaatatac
cttcgaaacggatattccacgtcatcagttacaattggttcaagcttccctcggttttgg
ccgggagtcccaatggatatttcaaatcaagcccaggagttctttatccatcgtgggttc
tgtcctgagcgtagaccaacagcaagggactacactgtcgacttactctcatacgaagca
ccaaagggcgtcttagagcgcgcagaaaaggcaggagtcacatatgctccctggagaaag
gaacaatatgaagaatgtatggagaaacagcgcaagctgtttggcaaagatcccgtgtgg
atggacgcttatgaagggctagcacaaacaggccagtacaaccaggtaatggtagcaacg
gactcatcgacaggtgagcagatcgggtggacattgatgcaggaattgggcatcgggatg
acacaggagctcgccatgcagccgctggtgggtatcaagtctggtcaaattggctgcgta
ggagttgttcctgaggcaagaaacaagggagtcggtctcgccctgatcacgcacgctgcc
cttgatctgaaacgacgagggatggagcatgtattcgtcgactggtcgaaccacgtcaac
tggtatgagcgtgctggcttcaaggtctggggcgagtatcggactatggtgttgcatgag
ctggcgaagactaactag

DBGET integrated database retrieval system