KEGG   Arthroderma benhamiae: ARB_02549Help
Entry
ARB_02549         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abe  Arthroderma benhamiae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_02549
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARB_02549
  Amino acid metabolism
   00310 Lysine degradation
    ARB_02549
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ARB_02549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MAESISEGTLKQFSKEIGDYVEQDEEIATIETDKIDVTVNATESGTIKEFLAAEEDTVTV
GQDLVRLELGAAPEGSKEKPAAAAPAAEESKPAEPKQETAAPAPKEESKEQPKEQPKKEA
APAPAPKQEKKTPAPEEAAKSTPGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEV
DMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNASIEGPNGGDTIVYR
DYVDISVAVATEKGLVTPVVRNVETMGLVEIEQSIADLGKKARDNKLTIEDMAGGTFTIS
NGGVFGSLMGTPIINLPQTGVLGLHAIKDKPVVVNGKIEIRPMMYLALTYDHRLLDGREA
VTFLVKVKEYIEDPRRMLLC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccatctcagagggtaccctcaagcagttctccaaggagatcggtgactac
gtcgaacaggacgaggagattgctaccattgaaaccgacaagatcgatgtgaccgtcaat
gccaccgagtccggcaccatcaaggaattcctcgccgcagaggaagacaccgtcaccgtc
ggccaggacctcgtccgtctcgagctcggtgctgctccagagggctccaaggagaagcct
gccgctgctgctcctgctgctgaggagagcaagcccgctgagcccaagcaggagactgcc
gcccctgctcccaaggaagagtccaaggagcagcccaaggaacagccaaagaaggaggct
gctccagccccagctccaaagcaggagaagaagactccggctcccgaagaagctgccaaa
tccacccctggcagcagagaagagcgcagggtaaaaatgaaccgtatgcgcctacgtatc
gccgaacgcctgaaacagtcccagaacaccgctgcctccctcaccaccttcaacgaagtc
gacatgtcctcgctcatggaattccgcaagctctacaaggacgacgtgctcaagaagacc
ggcgtcaagctcggcttcatgtccgccttctcccgtgcctgcgtgctcgctatgaaggac
gttcccgccgtcaatgcctcgattgagggccccaacggtggtgacaccatcgtctaccgc
gattacgtcgatatcagtgttgccgtggccacggagaagggccttgtcactcctgttgtg
cgcaacgtcgagaccatgggtctcgttgagatcgagcagtccattgctgatctcggcaag
aaggcccgcgacaacaagctcaccatcgaggatatggccggcggcaccttcaccatcagc
aacggcggcgtctttggctcgctcatgggcacccccatcatcaaccttccccagaccggt
gttctcggcctacacgccatcaaggacaagcccgtcgtagtcaacggcaagatcgaaatc
agaccaatgatgtatctcgccctcacctatgaccacagactgctcgacggccgggaagca
gtcaccttcctcgtcaaggtcaaggagtacatcgaggacccccgccgcatgctcctctgc
tag

DBGET integrated database retrieval system