KEGG   Arthroderma benhamiae: ARB_02549Help
Entry
ARB_02549         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abe  Arthroderma benhamiae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_02549
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARB_02549
  Amino acid metabolism
   00310 Lysine degradation
    ARB_02549
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ARB_02549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MAESISEGTLKQFSKEIGDYVEQDEEIATIETDKIDVTVNATESGTIKEFLAAEEDTVTV
GQDLVRLELGAAPEGSKEKPAAAAPAAEESKPAEPKQETAAPAPKEESKEQPKEQPKKEA
APAPAPKQEKKTPAPEEAAKSTPGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEV
DMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNASIEGPNGGDTIVYR
DYVDISVAVATEKGLVTPVVRNVETMGLVEIEQSIADLGKKARDNKLTIEDMAGGTFTIS
NGGVFGSLMGTPIINLPQTGVLGLHAIKDKPVVVNGKIEIRPMMYLALTYDHRLLDGREA
VTFLVKVKEYIEDPRRMLLC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccatctcagagggtaccctcaagcagttctccaaggagatcggtgactac
gtcgaacaggacgaggagattgctaccattgaaaccgacaagatcgatgtgaccgtcaat
gccaccgagtccggcaccatcaaggaattcctcgccgcagaggaagacaccgtcaccgtc
ggccaggacctcgtccgtctcgagctcggtgctgctccagagggctccaaggagaagcct
gccgctgctgctcctgctgctgaggagagcaagcccgctgagcccaagcaggagactgcc
gcccctgctcccaaggaagagtccaaggagcagcccaaggaacagccaaagaaggaggct
gctccagccccagctccaaagcaggagaagaagactccggctcccgaagaagctgccaaa
tccacccctggcagcagagaagagcgcagggtaaaaatgaaccgtatgcgcctacgtatc
gccgaacgcctgaaacagtcccagaacaccgctgcctccctcaccaccttcaacgaagtc
gacatgtcctcgctcatggaattccgcaagctctacaaggacgacgtgctcaagaagacc
ggcgtcaagctcggcttcatgtccgccttctcccgtgcctgcgtgctcgctatgaaggac
gttcccgccgtcaatgcctcgattgagggccccaacggtggtgacaccatcgtctaccgc
gattacgtcgatatcagtgttgccgtggccacggagaagggccttgtcactcctgttgtg
cgcaacgtcgagaccatgggtctcgttgagatcgagcagtccattgctgatctcggcaag
aaggcccgcgacaacaagctcaccatcgaggatatggccggcggcaccttcaccatcagc
aacggcggcgtctttggctcgctcatgggcacccccatcatcaaccttccccagaccggt
gttctcggcctacacgccatcaaggacaagcccgtcgtagtcaacggcaagatcgaaatc
agaccaatgatgtatctcgccctcacctatgaccacagactgctcgacggccgggaagca
gtcaccttcctcgtcaaggtcaaggagtacatcgaggacccccgccgcatgctcctctgc
tag

DBGET integrated database retrieval system