KEGG   Arthroderma benhamiae: ARB_02559Help
Entry
ARB_02559         CDS       T01611                                 

Definition
ubiquitin C-terminal hydrolase 37
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
abe  Arthroderma benhamiae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 514 aa AA seqDB search
MSVAGGRVSRQTLVFASASSSSSGSLEAVLMLGSNFLLFIFLQPRLGLARSRAKVSSAKA
SKTTLRGERRKGERAESVRAGRCEMGAPKKTATLDEGRDKGGRVRMAGGQKKDAAEDGLT
PLTSEERDSWNGFCEIENEPALFNAILKDIGVKGVKVQEVVSLDEEMLAFLPKPIYGLIF
LFRWREDDPHKQEQSCPESLWFANQTVENACATVALLNIIYNIEGIEMGEELKSFREFTK
DLSPAMRGYAIGNFEFVKKVHNSFARHDRNTTASADQYRKMDILSADMLLKNQQKWKARG
NQELDESEAGFHFIAFVKAKERVWKFDGLERQPQSLGKCVEEDWLGLATKEIQTKMAEYE
EGDIEFSILSLSKDPMTGYLADLASNVKALQHLNSRLAGFGENCDEADPENAVLCGPDAQ
YGLTPAMLELALVPSELAETAENGNEAHDLDSLARQRQALVEQQRLLRTQITDEQNSRQI
ELDYARRRRFDYCAAVNRWSRILVRKRKCEELLS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgcaggtgggcgtgtttctcgtcagaccctcgtcttcgcttcggcgtcgtcg
tcttcgtctggctcgcttgaagctgtgttaatgcttggaagtaattttttactttttatt
tttctgcagccccgattaggtttagcgcggtcacgggctaaagtttcctccgcgaaagct
tcaaaaacaaccttgagaggagaacgaagaaagggagagagagcagagagtgtgagagct
ggcagatgcgagatgggagcgccgaagaagacagctactctggacgaagggcgagataag
ggtgggagggtgaggatggctggtggtcagaagaaagacgccgcggaggacgggttgacg
cctctgaccagcgaggaaagggacagctggaacggcttctgtgagattgagaacgagcca
gcattattcaatgccatactaaaggacatcggcgtcaagggggtcaaggtgcaggaagtg
gtgtcgctggacgaggagatgctagccttcttgccgaaacccatttacggtctgatcttt
ctcttccgctggagagaagacgatcctcacaagcaagaacagagctgccctgagtcacta
tggtttgccaatcagacggtggaaaatgcatgtgccaccgtggcgttgctcaatataatc
tacaacatcgaaggtatcgagatgggagaggagctgaagtcgttccgggagtttaccaaa
gacctcagtcccgccatgcgaggctatgcgattggcaactttgaatttgtcaaaaaggtg
cacaactcgtttgccaggcatgacaggaacacaactgcatctgctgaccagtacaggaaa
atggacattctcagcgcagacatgctgctcaagaaccagcagaagtggaaggcccgagga
aaccaagagctagacgagtccgaggccgggtttcatttcatcgcatttgtcaaggccaag
gagagggtatggaaatttgacggtctagaacgacaaccccagagtctcggaaaatgcgtg
gaggaagactggcttggactggcaacgaaagagatccagacgaagatggcagagtacgaa
gagggagatatcgagttttccatcctaagcctgtccaaggacccgatgaccggatacctt
gccgacctggcatccaacgtcaaggctctccagcaccttaacagccgcttagccgggttc
ggagaaaactgcgacgaggcagaccctgaaaacgccgtgctgtgcggcccagacgcgcag
tacgggctgaccccggctatgctcgagctcgcattggtgcccagcgagctagcagagaca
gccgagaacggcaacgaagcacacgacctcgactcgcttgcgcgccaacgccaggccctc
gtcgagcagcaacgcctcctccgcacgcagataacggacgagcagaacagcagacaaatc
gagctcgactacgcccgccgccgccgcttcgactactgcgcggccgtcaaccggtggagt
cgcattctcgtccgcaagcgcaaatgcgaagagctgcttagctaa

DBGET integrated database retrieval system