KEGG   Arthroderma benhamiae: ARB_02588Help
Entry
ARB_02588         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARB_02588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MTGLFGNISSNTAAATSTTTGDISKDVALVAPPEDSISDLAFSSQSDHLAVASWDKKVRI
YEINEQGMSEGKAMFEHQAPVLNCCWSPDGSKVVGVGVDKAARMLDLQGNPTTPVQVAAH
DAPIRSCCMIQNPGNSAQPLLVTGSWDKTVKYWDLRQSTPIGTLQCQERVYSMDVSKTLL
VVATADRYINIIDLNQPTNIYKVMQSPLKWQTRVVSCFTDGTGFAIGSIEGRCAIQYVEE
KDSSSNFSFKCHRETPQGQSNVSNVYSVNSIAFHPQHGTFSTAGSDGTFHFWDKDAKHRL
KGYPSVGGTISTSTFNRNGNIFAYAVSYDWSKGYTGNTPQTLNKVMMHPVTPEEVKPRAT
SANARRNR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcctgtttggcaacatctcctccaatactgccgcagcgacctccacaacaacg
ggcgatatctcaaaagacgtagccctggttgcgccgccagaggatagcatttcagaccta
gccttctccagtcagagcgaccacctagccgttgcatcatgggacaagaaagtgcgcatc
tacgagatcaatgagcaggggatgagcgaaggaaaggccatgttcgaacaccaggcaccc
gttcttaattgctgctggtctccggatggctcaaaagtggttggtgtcggagtagacaaa
gctgcccgtatgcttgaccttcagggtaaccctaccactcctgtccaggtcgctgctcat
gacgcgcccatccgaagctgctgcatgattcaaaacccgggaaactcggctcagccgctc
ctcgtcactggctcgtgggataaaaccgttaaatactgggacctaaggcagtctacccca
attgggactctacagtgccaggagagagtctactccatggacgttagcaaaactctactc
gttgttgccacagccgacaggtatatcaacatcatcgacctcaatcaaccaacgaatatc
tacaaagtcatgcagtctccactcaagtggcagacacgggttgtgagctgctttaccgac
ggaacagggttcgctataggaagtatcgaaggccgatgcgccattcaatatgttgaggaa
aaagactcgagctcgaatttcagcttcaaatgccaccgtgaaaccccccagggccaatca
aacgtgagcaacgtttattctgtcaactctattgctttccatcctcaacacggcacattc
agcactgctgggagcgacggaaccttccacttctgggataaagacgcaaaacatcgtctc
aagggttatccatccgtcggaggcacaatatccacttcaacattcaacagaaacggtaat
atttttgcgtatgccgttagctatgactggagcaaaggttatactggcaacaccccccag
acactgaacaaagtcatgatgcacccagtcacgccggaggaagtaaaaccaagagcaaca
tcggcaaatgcacgaaggaatagataa

DBGET integrated database retrieval system