KEGG   Arthroderma benhamiae: ARB_02602Help
Entry
ARB_02602         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
abe  Arthroderma benhamiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARB_02602
Enzymes [BR:abe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ARB_02602
Exosome [BR:abe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARB_02602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MSFSNLVSDIAFRDSQGDERIPKGPRSHAAAPSSYQSTTTSVSISGSISSQLHAGYNHPL
TREWQAERQLTKAMLMYPLFITDRPDDQIPVPSLPNQYQIGLNKLIPFLKPLIKKGLRSV
ILFGVPLAPGAKDALGTMADDPSGPVIQAIRLLRSTFPSLYITADVCMCEYTSHGHCGIL
REDGSLNNTLSVERLSDIAVAYAQAGAHCVAPSDMNDGRVRAIKLKLIEAGISHQVVLMS
YAAKFSGCLYGPFRDAAGSSPSFGDRKCYQLPPSGRGLARRAIQRDINEGADIIMVKPAG
AYLDIISDAKELGRDLPVAAYQVSGEYAMIHAGAKAGVFELKAMVMESMQGILRAGGSIV
TTYFVPELLDWLES
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctctaacctcgtgtcggacattgcgttcagagactcccagggcgatgagcgt
atacccaaaggccctcgctcccatgctgctgccccgtcttcataccagagcacaaccaca
agtgtcagcatttcagggagcatttccagccagcttcatgcaggatacaaccacccgtta
actagagaatggcaggcagaaagacaattaaccaaggccatgctcatgtaccccctcttc
atcacggacagacccgacgaccaaattcccgtgccttcgctaccaaaccaataccagatt
ggcctgaacaagctgatcccattccttaagccattgattaaaaagggcctaaggtccgtc
atcctcttcggcgtaccattggccccaggagccaaagatgcactggggaccatggcagat
gacccttccgggcccgtgatacaagccattcgcctattacgcagcactttcccctcgttg
tacatcacggcagacgtgtgtatgtgcgagtacacctcccacggccactgtggcatcctg
cgcgaagacggatcattaaataacacgctctcagttgagaggctgtctgatatcgctgtg
gcgtatgcacaagctggagcacactgcgttgctccctctgatatgaatgatggacgggtc
agggcgatcaagctcaagctcattgaagcaggtatttcgcatcaagtggttctcatgtcc
tatgcggcgaagtttagcgggtgtctctatgggcccttcagggatgctgcaggatcatcg
ccttcgttcggtgatagaaagtgttatcagctcccgcctagtgggagggggctggcgagg
agagctattcagagagatattaacgaaggggctgatatcatcatggtaaagcctgcagga
gcctatttggatatcattagtgacgcgaaggagctagggagggatcttcctgttgccgcg
taccaagttagcggggaatatgcaatgatccatgctggtgcgaaggccggtgtatttgag
cttaaggcgatggtaatggagagtatgcaaggaatactcagggctggtgggagtattgtg
acgacgtactttgttccagagctgctggactggttagagtcttaa

DBGET integrated database retrieval system