KEGG   Arthroderma benhamiae: ARB_02602Help
Entry
ARB_02602         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
abe  Arthroderma benhamiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:abe00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MSFSNLVSDIAFRDSQGDERIPKGPRSHAAAPSSYQSTTTSVSISGSISSQLHAGYNHPL
TREWQAERQLTKAMLMYPLFITDRPDDQIPVPSLPNQYQIGLNKLIPFLKPLIKKGLRSV
ILFGVPLAPGAKDALGTMADDPSGPVIQAIRLLRSTFPSLYITADVCMCEYTSHGHCGIL
REDGSLNNTLSVERLSDIAVAYAQAGAHCVAPSDMNDGRVRAIKLKLIEAGISHQVVLMS
YAAKFSGCLYGPFRDAAGSSPSFGDRKCYQLPPSGRGLARRAIQRDINEGADIIMVKPAG
AYLDIISDAKELGRDLPVAAYQVSGEYAMIHAGAKAGVFELKAMVMESMQGILRAGGSIV
TTYFVPELLDWLES
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctctaacctcgtgtcggacattgcgttcagagactcccagggcgatgagcgt
atacccaaaggccctcgctcccatgctgctgccccgtcttcataccagagcacaaccaca
agtgtcagcatttcagggagcatttccagccagcttcatgcaggatacaaccacccgtta
actagagaatggcaggcagaaagacaattaaccaaggccatgctcatgtaccccctcttc
atcacggacagacccgacgaccaaattcccgtgccttcgctaccaaaccaataccagatt
ggcctgaacaagctgatcccattccttaagccattgattaaaaagggcctaaggtccgtc
atcctcttcggcgtaccattggccccaggagccaaagatgcactggggaccatggcagat
gacccttccgggcccgtgatacaagccattcgcctattacgcagcactttcccctcgttg
tacatcacggcagacgtgtgtatgtgcgagtacacctcccacggccactgtggcatcctg
cgcgaagacggatcattaaataacacgctctcagttgagaggctgtctgatatcgctgtg
gcgtatgcacaagctggagcacactgcgttgctccctctgatatgaatgatggacgggtc
agggcgatcaagctcaagctcattgaagcaggtatttcgcatcaagtggttctcatgtcc
tatgcggcgaagtttagcgggtgtctctatgggcccttcagggatgctgcaggatcatcg
ccttcgttcggtgatagaaagtgttatcagctcccgcctagtgggagggggctggcgagg
agagctattcagagagatattaacgaaggggctgatatcatcatggtaaagcctgcagga
gcctatttggatatcattagtgacgcgaaggagctagggagggatcttcctgttgccgcg
taccaagttagcggggaatatgcaatgatccatgctggtgcgaaggccggtgtatttgag
cttaaggcgatggtaatggagagtatgcaaggaatactcagggctggtgggagtattgtg
acgacgtactttgttccagagctgctggactggttagagtcttaa

DBGET integrated database retrieval system