KEGG   Trichophyton benhamiae: ARB_02611Help
Entry
ARB_02611         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
abe  Trichophyton benhamiae
Pathway
abe00230  Purine metabolism
abe01100  Metabolic pathways
Module
abe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARB_02611
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ARB_02611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin DUF3774
Motif
Other DBs
NCBI-GeneID: 9523663
NCBI-ProteinID: XP_003011089
UniProt: D4B2K3
AA seq 166 aa AA seqDB search
MRYVFRGYADTTRGPRPGEEDGREYNFTTKEAFLKLVDEGGFIEHAQFGGNHYGTSIAAV
KRVADQGRICVLDIEMEGVKQVKRTDLNARFLFLAPPSIEELERRLRGRGTESEDSLQKR
LAQARVELEYSRQPNAHDKIVVNDELEAAYAELRDWVVDGGKFGSQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgtgttccgggggtatgcagacaccactcgaggccccagaccaggcgaggaa
gatggcagggaatacaacttcaccaccaaggaagctttcctgaagctcgttgacgaggga
ggattcattgagcatgctcagttcggcggaaaccattacggaaccagcattgcggccgtg
aaacgtgttgcggaccaagggagaatatgcgtcctagacattgagatggagggtgtgaaa
caagtgaaacggaccgatctcaatgccaggttcctcttccttgctcctccgtctatcgaa
gagttggaaagacgcctgcgtggtcgcggtactgagtcagaggacagtctgcaaaagcga
ctggcccaggcccgagttgagttagaatactcgaggcagcctaatgcacatgacaagatt
gttgttaacgatgagcttgaggcggcatatgccgagcttagagattgggtggtagatggc
gggaagtttggctcgcaatga

DBGET integrated database retrieval system