KEGG   Arthroderma benhamiae: ARB_02626Help
Entry
ARB_02626         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
abe  Arthroderma benhamiae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ARB_02626
Enzymes [BR:abe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ARB_02626
Exosome [BR:abe04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ARB_02626
  Exosomal proteins of colorectal cancer cells
   ARB_02626
  Exosomal proteins of bladder cancer cells
   ARB_02626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MPGVRSLLLALAGVSLAPAVLAADASTDSSDVHALKTDTFKDFIKEHDLVLAEFYAPWCG
HCKALAPEYEKAATELKSKNIQLAKVDCTEEADLCQEYGVEGYPTLKVFRGLDSHKPYNG
ARKSPAITSYMIKQSLPSVSVVTAENFEEVKSLDKVVVVAFIGEDDKETNKTYTALADSM
RDDVLFAGTSSAELAKKEGVSLPAVVLYKEFDDRKDVYDGKFEAEALKAFIKSSSTPLVG
EVGPETYSGYMSAGIPLAYIFADTAEEREQYASDFKDLAKKLKGKINFATIDSKAFGAHA
ANLNLIPEKFPAFAIQDTVSNKKYPFDQEKKLTKQDITKFVEGVIAGDIAPSVKSEAVPE
TNDGPVTVIVAHTYEEIVMNKDKDVLVEFYAPWCGHCKALAPKYDQLGSLYKDNKDFASK
VTIAKVDATANDIPDEIQGFPTIKLFPADDKDKPVEYTGSRTIEDLANFVRDNGKHKVDA
YDEKKVEKDGSDVTGKPKDAEAPPKPSDAPESEEKADKEHEEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcgtccgtagcctcctcctcgccctcgccggcgtctctctcgctcccgccgtg
ctcgccgcagacgcctcgacagactcgtcggacgtccatgccctgaagacagacaccttc
aaggacttcatcaaggagcatgacctcgtcctggccgagttctacgccccctggtgcggc
cactgcaaggccctcgctcccgagtatgagaaagcagccaccgagctcaagagcaagaac
atccagctcgcaaaggtcgactgcaccgaggaggccgacctctgccaggagtacggcgtc
gagggataccctacgctcaaggtcttccgtggccttgactcgcacaagccttacaacggt
gctcgcaagtccccagccatcacctcgtacatgatcaagcagagcctgccatcagtctcg
gttgtgacagcagaaaacttcgaggaggtcaagtccctggacaaggtcgtcgtcgtcgcc
ttcattggcgaggacgacaaggagaccaacaagacctacactgccctcgctgactcaatg
cgggacgatgtcctctttgccggcaccagcagcgctgagctggccaagaaggagggtgtc
tcgctccccgctgttgtcctctacaaggaattcgatgaccgcaaggacgtgtatgatggc
aagttcgaggccgaggctctcaaggctttcatcaagtcctccagcacacccctcgttggt
gaggttggcccagagacctactctggatacatgtcggctggcatccctcttgcatacatc
tttgctgacactgctgaggagcgtgagcagtacgctagtgacttcaaggacctcgccaaa
aagctaaagggcaagatcaacttcgctaccatcgactccaaggcctttggtgctcacgct
gccaacctcaaccttatccctgagaagttccctgccttcgccatccaggacactgtttcc
aacaagaagtaccccttcgaccaggagaagaagctcaccaagcaagacatcaccaagttc
gttgagggtgtcatcgccggtgacattgctcctagtgtcaagtccgaggccgtcccagag
acgaatgacggcccagtcaccgtcatcgtcgcccacacctacgaggagatcgtcatgaac
aaggacaaggatgtcctcgtcgagttctacgctccttggtgcggacactgcaaggctctc
gctcccaagtacgaccagctcggcagcttgtacaaggacaacaaggacttcgcctccaag
gtgaccatcgctaaggtcgatgccaccgccaacgacatcccagacgagatccagggcttc
cctaccatcaagcttttccctgccgacgataaggataagccagtcgagtacaccggctct
cgcaccatcgaggacctcgccaacttcgtccgtgacaacggcaagcacaaggtcgacgcc
tacgatgagaagaaggtcgagaaggatggcagcgatgtcactggaaagccaaaggatgcc
gaagccccaccaaagccttctgatgctcccgagtctgaggagaaggctgacaaggagcat
gaggagttgtag

DBGET integrated database retrieval system