KEGG   Arthroderma benhamiae: ARB_02658Help
Entry
ARB_02658         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
abe  Arthroderma benhamiae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abe00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 158 aa AA seqDB search
MSQVSHTTRGPRPGEVEGVAYYFTKDDAFSALVSQDGFVEHATFNGHRYGTSKQTISGLA
EKGLIAVLDIDIQGVKQLKAASSIDARYVFIVPPSLECLEARLRGRGTEAEEDIQHRLSK
AITELTYADIPGFFDKIIVNDDLNSAYDELVQFAHGIS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtgtctcataccacacgaggacctcgacctggggaagttgagggcgtagcc
tattactttacaaaggatgatgcattttctgcactcgtctcacaagatgggttcgttgaa
catgccaccttcaacggtcaccgttatggtacgagtaagcaaaccatctcgggcttggct
gagaaggggctcattgccgtgcttgatattgacatacaaggtgtcaagcaattaaaggca
gcctctagtattgatgcccggtatgtatttattgtaccgcccagcctggaatgccttgaa
gcccggcttaggggacgtggtacagaagcagaagaggatatccagcaccgactttccaaa
gctattaccgaactcacctatgctgatattcccggcttttttgacaaaatcattgtcaat
gatgatttgaacagcgcttatgacgagcttgtccaatttgctcatgggattagctga

DBGET integrated database retrieval system