KEGG   Arthroderma benhamiae: ARB_02740Help
Entry
ARB_02740         CDS       T01611                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
abe  Arthroderma benhamiae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARB_02740
   00240 Pyrimidine metabolism
    ARB_02740
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARB_02740
   03410 Base excision repair
    ARB_02740
   03420 Nucleotide excision repair
    ARB_02740
   03430 Mismatch repair
    ARB_02740
   03440 Homologous recombination
    ARB_02740
DNA repair and recombination proteins [BR:abe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ARB_02740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 194 aa AA seqDB search
MAPRRKAAESRKSNQATLQFGSQSKISKPFSNASIPGKDLKQKSTSPKEISLPTHSLPKK
QDEGQQQLQEPTAEVTATPASTTSTAVVHEQARAEAALPKSKEDEQAEALTLKQLHAYWR
AEERKRTASRANKQQKQADRNIFCQPCIGIARIKRWRRAHALGLNPPIEVLAVLLKGETR
EKASEKAYIDELLS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgccgaaaagccgccgagtcgcgcaaaagcaaccaggcaaccctccagttc
ggctcgcagtcgaagatatcaaagcccttctccaatgcctcgatacccggcaaggacttg
aagcagaagtctacctcgcccaaggagatctccctgcccacccacagcctgccaaagaag
caggacgaggggcaacaacagctgcaagaacctaccgccgaagtcacggccactccagca
tccacaacttcaacagccgtcgtacacgagcaggccagagccgaggcagcgttaccaaag
tcgaaggaagatgagcaggcagaggcattgacgttgaagcagctgcatgcgtactggcgg
gcggaggagagaaagcgaactgcctcgagagcaaacaagcagcagaaacaagctgaccga
aatatcttctgtcagccatgcattggaattgcacggataaaacgctggagacgagctcat
gctctcggcctgaatccgcctattgaagtccttgccgtcttgttaaagggagagacgcgg
gagaaagcgagcgagaaggcatacatagacgagttgctatcgtga

DBGET integrated database retrieval system