KEGG   Trichophyton benhamiae: ARB_02915Help
Entry
ARB_02915         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe00220  Arginine biosynthesis
abe00330  Arginine and proline metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01230  Biosynthesis of amino acids
Module
abe_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ARB_02915
   00330 Arginine and proline metabolism
    ARB_02915
Enzymes [BR:abe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ARB_02915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9524991
NCBI-ProteinID: XP_003010876
UniProt: D4B381
AA seq 355 aa AA seqDB search
MWTTCEQQHIYQADSQTADDTTHGQPAKMTSPTTTIAQKFLSRPQELGVVAVGFSDGQPK
AGVDAGPTALLEAGLLDQVRDELGYKVDFDSKVHDYADVKPAESEDPRYRNMIKPRTVSA
VTRRLSEQVYEHAREGKMVLTLGGDHSIAIGTVSGTARAIRERLGREMAVIWVDAHADLN
RPEESESGNVHGMPVSFLTGLAKDEREDVFGWLTKDHLISTRKLVYIALRDVDRAEKQTL
REHGIKAFSMHDVDRHGIGRVVEMALAHIGNDTPIHLSFDVDALDPQWAPSTGTPVRGGL
TLREGDFIAECIHATGNLIAMDLVEVNPSLASMGASETVRAGCSLVRCALGDTLL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtggacgacctgcgagcagcaacacatatatcaagcggatagccagactgcagacgac
acgacacacggacagccagcaaagatgacttcccctaccacgaccatcgcgcagaagttc
ctctcccggccccaggagctgggcgtcgtcgccgtgggcttttccgacggccagcccaaa
gccggcgtggatgcgggcccgacggcgctgctggaggccggcctgctggaccaggtgcgc
gacgagctcggctacaaggtcgacttcgacagcaaagtgcacgactacgccgacgtcaag
cccgcggagagcgaggacccgcgataccgcaacatgatcaagccccggaccgtctctgcg
gtgacccggcggctgagcgagcaggtctacgagcacgcccgcgagggcaagatggtgctg
acgctgggcggcgaccactcgatcgccatcggcaccgtctcgggcaccgccagggccatc
cgcgagcgcctcggccgtgagatggcggtgatctgggtcgacgcccacgctgacctgaac
cgcccagaggagagcgagagcggcaacgtccacggcatgccggtgtcgttcctgacggga
ctggccaaggacgagcgcgaggacgtcttcggctggctgaccaaggaccacttgatcagc
acccggaagctggtctacattgccctgcgagacgtcgaccgtgccgagaagcagacgctg
cgcgagcacggcatcaaagcctttagcatgcacgacgtcgaccgccacggcatcggccgc
gtcgtcgagatggccctcgcccacatcggcaacgacacccctatccatctgtccttcgac
gtcgacgccctcgacccccagtgggcgcccagcaccggcacgcccgtccgcggcggcctg
accctgcgcgagggcgacttcatcgccgagtgcatccacgccaccggcaacctgatcgcc
atggacctggtcgaggtcaaccccagcctggcctcgatgggcgccagcgagaccgtccgc
gccggctgctcgctcgtccgctgcgccctgggcgacaccctgctctag

DBGET integrated database retrieval system