KEGG   Arthroderma benhamiae: ARB_02969Help
Entry
ARB_02969         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
abe  Arthroderma benhamiae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_02969
   01210 2-Oxocarboxylic acid metabolism
    ARB_02969
   01230 Biosynthesis of amino acids
    ARB_02969
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARB_02969
Enzymes [BR:abe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ARB_02969
Amino acid related enzymes [BR:abe01007]
 Aminotransferase (transaminase)
  Class I
   ARB_02969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 597 aa AA seqDB search
MATPRMNRTNINPNVINAQYAVRGELAVKAEEYRLALERGEKLPFDKVIFANIGNPQQLE
QKPITFSRQVLSLLEYPPLLQNEEALKSTFGYKSDVIARAKTLLADVQSVGAYSQSLGAP
GIRQSVADFIARRDGFPASQKDIYLTGGASAGVSTILNVICAGKKTGVLVPIPQYPLYTA
TLSLLDATCVPYYLNESQSWATDVEEIKTSLANGEKAGTDIRAIVIINPGNPTGASLNPA
AIKDVIDIAAEKSLVIIADEVYQTNVFKGEFTSFKKRLRELQAEFPGKYDGIELVSLHSV
SKGMVGECGHRGGYFELVGFKPEVVEQVYKFVSINLCPPVIGQCLLECMVHPPVEGEESY
ELYQKEYNSIADGLKQRAFALYEAFKKMEGVECQEPQGAMYLFPTIHLPPKAVDAATKAG
RKADEFYCLRLLDATGVCVVPGSGFGQKEGTLHFRTTFLAPGTDWVDRIVKFHGEFMNEF
RDPLCLTSIPVVIVSQSTVALSSTKYSFLRSNVSTEFTNSRPNSYMQPLSSQPCKLLLRD
KPAIAPANSKFHPDSPRGEPGNRRQLNLGDSEKHPELTVDLSIRKASRIKMLEVLCT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccccgtatgaacaggaccaatatcaaccccaacgttatcaacgcgcagtat
gctgtccgaggagagctggcggtgaaagcagaagagtaccgactcgctcttgaaagaggg
gaaaagctgccattcgataaggtcatcttcgccaacatcgggaatccgcaacagctcgaa
caaaaacccatcaccttctcccgccaggtgctgagtctcttggagtaccctcccctcctc
cagaacgaagaagccctcaagtcaacctttgggtacaaatcggacgttattgcgcgggca
aagacgctgctagcagacgtccagagtgttggtgcatacagccagagtctaggagcaccc
ggtatcagacaaagtgttgcagacttcatcgcccgccgagacggattcccggccagccag
aaagatatctacttgactggcggtgcatctgcaggagttagcactattctgaacgttatc
tgcgctggcaaaaagaccggagtgcttgttcccatcccccaataccctctgtacaccgca
actctctccttgctcgacgctacatgcgtgccatactacctgaatgaatctcaatcttgg
gccacagatgtcgaagagattaaaacctcgcttgctaacggcgagaaggctggaacagac
attcgtgccattgtgattatcaatcctggaaaccccacgggagccagcctcaatcccgcg
gccatcaaggatgtaattgatattgccgccgaaaagagcctggtcatcatagccgacgaa
gtataccagaccaacgttttcaagggcgagttcacatccttcaagaaacgtctacgtgag
ctccaggctgagttccctggtaagtacgacggcattgagctagtttcactacactcagtc
tccaagggaatggtcggtgaatgtggccatcgaggaggatattttgaactcgtcggtttc
aaacctgaagtggtcgagcaggtctacaagttcgtgagcatcaatctctgtccacctgtg
atcggccagtgtttgctcgagtgtatggttcacccgccagtagaaggtgaggagagctac
gaactatatcagaaggagtataacagtattgccgacggactcaagcagcgtgcgtttgct
ttgtatgaagccttcaagaagatggagggcgttgaatgtcaagagcctcagggagctatg
tatctcttcccaaccatccatctaccacccaaggccgttgatgctgccaccaaggcaggc
cgtaaggcagacgagttctactgtctccgtctcctcgatgcgacaggtgtctgtgtcgtc
cccggctcaggctttggacagaaagaaggcactctgcacttccgcacaaccttcctagct
cctggaactgactgggtagaccgcattgttaaattccacggtgaatttatgaatgaattt
agagatcctctctgcttgacgagcatccctgtcgttattgtttcccagtcaactgttgcc
ctctcgtctactaaatactcgtttctacggagtaacgtatccactgaatttaccaactct
cgaccaaactcctatatgcagcccctttcctcccaaccatgtaaactgcttcttcgggac
aaaccggcgattgccccggcaaactccaagtttcacccggattctcctcggggagagccg
gggaaccggagacaacttaaccttggagacagcgagaaacacccggaattaaccgtcgat
ctcagtatcagaaaggcctcaagaatcaagatgttggaagtgctctgtacataa

DBGET integrated database retrieval system