KEGG   Arthroderma benhamiae: ARB_03360Help
Entry
ARB_03360         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ARB_03360
Peptidases [BR:abe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARB_03360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MNSYPGYHYPPRQRASIRGNHHDPPSRHAGDRTSLVYALVSLASVYFLLYTFGISPYFFP
RLIWKIVVYWTPSRLVAALDKDKTRNSSASDESYTGYRNLYEKGQAMQRIIGHTTTSIIP
LLPRSRAYTSLSSVLLGSNDVYPAGLGNWDNSCYQNSIIQGLASLRSLREFLGLNIQNLG
HRHPLSTHIALRVIIDKLNDPENAGQKLWLPAELKSMCSWQQQDAQEYFSIIADQVDKEI
RGASKGITSDIGLKTVRQDGHRAEATLPSPPLTEDGQATPDEPDTDRSCVPYCSPLEGLL
AQRVGCMECGWTDGLSLIPFNCLTVSLGKKWEYDIRECLDDYTSLETIEGVECAKCTLQR
TQAQLEQLLGKIDPVEESQEETDSGKLNEALRRNAESRLNAVLESLQNDDFSEKTLKEKC
HISSRNHVASTKSKQAVIARPPKSLIIHINRSVFDEMTGTLRKNYADVRFPKSLDLDEWC
LGTMPTNGDSKDEVVETWGINPSESMLPRPESEINGFDRRYELRAVITHHGRHENGHYIC
YRKYPVESFPIEVPQPVIEADGIKEKKEHWFRLSDEDVTLVSESSVLAQGGVFMLCYELA
GSSPEISRGISQAVPGRDTKSISGSQVVEDGIPLGEVPRGPGSVAESRADETDWSRRTNT
DSVSSHSSNLSENSSQSSIGNEEPVIDNRPQKPATPMKTSNGSNIGSHENPSASSVPQMI
KAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaactcctacccgggttaccactaccctcccagacagcgagccagcatacgcggaaac
caccatgatcctccttccagacacgctggcgacaggacttccttagtatacgctcttgtt
tctctggcgtccgtctacttccttctctacaccttcggtatctcgccatacttttttcct
cggctgatctggaaaatcgtcgtctactggaccccgtcgcggcttgtggctgctttggat
aaggacaaaacacggaacagttcggcttcggacgagtcttatactggttaccgaaatttg
tatgaaaagggacaggcaatgcagagaatcatcggtcacaccacaacttccattattccg
ttgcttccgcggtcaagagcgtacaccagcctcagcagtgtgctactggggtccaacgat
gtctatcctgcggggctcgggaactgggataattcctgctaccagaattccataattcaa
ggccttgcctcccttcgttcgttgcgagagttcctgggattgaacatccaaaacctgggg
caccgccacccactttcaacacacattgctctgagagtgatcatagacaagcttaacgat
cccgaaaatgctggccagaagttgtggttacctgcggaactcaagtctatgtgcagttgg
cagcaacaggacgcccaggaatatttttccatcatcgcagaccaagtggataaagagatt
cgtggagcatcaaaggggattaccagtgatatcggcctcaaaacagttcggcaagatggt
caccgcgccgaagcgactttaccaagtcctcctttgaccgaagatggtcaggcaaccccc
gatgagccagatacagatcggagctgtgtaccttattgtagcccgttggaggggcttctg
gcccagagagtggggtgcatggaatgcggctggaccgatggcctctcacttattccattt
aactgcctgacggtttctctgggcaaaaaatgggaatatgatatcagggagtgccttgac
gattataccagcttagaaaccatcgagggtgtggaatgcgccaaatgtaccttgcaacgg
acacaggcgcagctcgaacagctactaggcaaaatcgacccagtggaagaatcacaggag
gaaacagactcgggcaaactcaatgaagcgttgagaagaaatgccgaatcgaggttgaat
gcagttcttgaatcacttcagaatgacgattttagcgaaaagacattgaaggagaaatgc
cacatctcttcgcgcaatcatgtcgcctcaacaaagtcgaagcaggcggtaattgcaagg
ccacccaaatctctaattatacatatcaaccgcagcgtctttgacgaaatgacgggtaca
ctaaggaagaactatgcggatgtgaggtttccaaaatctttggatttagatgaatggtgt
ttgggtaccatgccaacaaacggcgattccaaggacgaggttgtcgaaacttggggtata
aatccctctgagtcgatgcttcctcggccagaaagcgaaatcaatggcttcgatagaaga
tatgagctacgagctgtaatcacgcatcacggacgtcatgagaacggccactacatttgt
taccgaaaatatcctgtggagtcgttccctattgaagttccccagcccgtcattgaggct
gatgggatcaaggaaaagaaggaacactggttcaggctgagtgacgaggacgtcaccttg
gttagcgagagcagtgttctcgctcaaggaggcgtgttcatgctctgctatgaactggca
gggtcatcgcctgaaattagtaggggtatctcccaggcggttcctggtagagataccaag
tccattagtggatcgcaggtggttgaagatgggataccacttggagaagtaccacgcggg
cccggaagtgtcgcagagtctcgagcagacgagaccgactggtctaggagaaccaacacc
gattccgtatcatcacactcttcgaacctttctgaaaacagcagtcagtcttctattgga
aacgaggagccggtcatcgacaacagaccacagaaaccggccacgcctatgaaaacatcg
aacgggtcaaatattggctcgcatgagaatccaagtgcctcctcggtaccacagatgata
aaagccctgtag

DBGET integrated database retrieval system