KEGG   Arthroderma benhamiae: ARB_03386Help
Entry
ARB_03386         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARB_03386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1687 aa AA seqDB search
MEGDESSNNLRGLYQDLSALSRFALPNAERLVAELEATLEDFRRLLDKPAKNNDSRKTVL
SGKIKLDDVEYEVNVEFQQEVLQVADALDVDEIEAARYYIRAQSDSKKLDRSPIVSSIIR
FHEQREFVLECLRLILHESFEVEREETQLLMKEYVASVLEIQNGPLRNGSLFARKCMDAM
TDIEKWLVLLGEQIQKASIVGQSQEADILEVIEYQKQSLGKQHESLGAIVSYLFKGTYTS
SEDFRKLMEKTKKVDKFDMLLVHYVPSIITAASQYGSSEGQGIEDARSLHKVIVESKDSQ
GWVLPQFHAAAIVFWLAEYSGWYFDSTAAGPIQGLNSAEESAKLSKSLLAALEDGGFHFI
LSICAGVGLDEWKNAERNELVTLLLKDAARLTLEPDAPSPYFHSLLMESIEGFTESLIAN
MPDAIRMLKSEEDTQRLDQITALRDSVSPNLHRGPVEVRMHLECLLTIIAFSFDGRNDAA
QEFWLDPDGNLYGFLQWVSKRQTVPRASAFCEMLCSISGGEENSAAAHKFLIDEDSLSSA
KFRRSASMNWTQMFAEIQLYAVRITERPSTTQSSTLRLRKLEVPDIEEPESPIMLTSYLR
LISHLSRENSKIREWILQHQTTNLISVLLTLCGASIPQHLRAAIFVTLRCLMIDRTSAHS
NEMWTSLDNCISGSGSLPLALSPLPPLSSPQVRNERHAFQRITESFDQMNAFVEMLNQLV
GPVSDSLDSQLTLPFPESLGSTYRMPGIEPYVDYVMGQAFANRSVMAEDKESHLLQWNCM
NFAATALESFNENLISIVSQPSISAQPNWKVTFSTYLRLHPFSRVMEWLFNEDVLRVLFS
CSHRDADGVSKASSDSILISSLVRSIDIMNLILDHQPTYFNIVRPIIKSSGQDSSFNIAN
STLASFEDCVIDNLGLISDLCLYCGTGHPQLTLTSLALLEKLSASRKLNKSSNISSRWQS
TNQMVEQLNSNVEADRVARSLASQIDVDIRELESGPESSGYLIKMGLLQLLDKCLKMSPE
KPTIAHLLLGFSCLGNTLDIPPDGLFENGISLLHSILEFVKAYPLGMDGAVISWMIHLRR
LGFQVLLNLWASPLSSNLTLPHLRAGQLLPVLFMSQPVVTAETLWDDFRTNEPDFWLSSS
PSSLSELLMLRTLLYEYATTEVRAVYKQGSPSVQRDTLRTILGTTSVEGDQSVEHPSLFD
LFDFADIDIDFSYTWPELQFFGSVNVESCVKTEENGVVVLYDIEALQELLQLVKEDLVAD
GVVTSQNEEQIMAEKEKLLLFLSATNEFRYVQFNRFVALKAWTELVTIITVTCKMDPTYM
ASFIQQTLQLILPKFESSIVETPAEAIELAHLGETLIDKLDKIPTDTNGDVIDERLDYLF
QVCTSGIPQTSDNITLRESLYQISSKHLARITASSSTDDRFKEHAHSTVKAAGPTLMETI
CDDAYGSSESCRVSALVLLNLLGILDQQRNSSLLVNLITHSNYLGMFLDVLRVMPSEFRN
AKATDTAQLLLFYESQLSLLQQLSQTKAGASQLLDAGLFQAVKESQLFSADPDIGIVTVF
INQEFLLDIDNSDALQRYYELLLSVLQVIVSTIFSRGLHNQAICDQTRAFLSENRQSMVG
IFKRCAKSGSSDDPSMKKCLDNLAKSYTALIASVDFLDVSAFPLLRLFPIHPHHPHAPEA
SYLQTSE
NT seq 5064 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgatgagagctctaacaacttacggggcctatatcaggacctgtcagccttg
tccaggtttgctcttcccaatgcagagaggcttgtggccgagttggaagcaacacttgag
gacttccgcaggctgttagacaagccagccaaaaacaacgacagcagaaagactgttctt
tcaggcaaaattaagcttgacgatgtcgaatatgaggtcaacgtggagttccagcaagaa
gtattgcaggtggcagatgctttggacgtcgatgaaattgaggctgcgcgctattatatt
cgtgcacaatccgattctaagaagctagatcgatcgccaatcgtcagctctataatccgt
tttcacgaacaaagagagttcgttctagagtgcctgaggctcatccttcacgagtctttt
gaggtagaacgggaagaaactcagctcttaatgaaggaatatgttgcatcggtacttgaa
atccagaatggccctttacgcaatggctcgctatttgctaggaaatgcatggacgcgatg
acagacatcgaaaagtggttggttcttttgggggaacagatacaaaaggcatcaattgtt
gggcagtctcaggaagctgatattcttgaagttattgaatatcaaaagcaaagtcttggg
aaacagcatgaatctttaggagccatcgtgtcctacctcttcaaaggcacctacacaagc
tctgaagacttccgcaaactcatggaaaaaacgaaaaaggtcgacaaatttgacatgcta
ctcgtccattatgtcccctcaatcataaccgcggcctcccaatatggctcatcggagggt
caggggattgaagacgcaagatccttacacaaagtgattgttgagtcaaaggattcccaa
ggctgggtactcccccagtttcacgctgccgccatagtcttttggctagcggagtatagt
ggctggtactttgatagcacggcggctggaccgattcaaggtttaaattctgccgaagag
tccgccaagctatcaaaatcacttctcgctgccctcgaggacggtggttttcactttatt
ctaagcatttgcgctggagttggtttggatgaatggaaaaatgcagaaaggaacgagctg
gttacactcttactaaaggatgcggcccgtctgactctcgaacccgacgctccctcgcca
tatttccattctttactcatggagagtatcgaaggcttcaccgagtctctgattgcaaac
atgcccgatgctatccgaatgctgaagtcggaagaagatacccagcgattggatcagatt
actgcgctcagggactcagtttccccaaatctccaccggggtcccgtagaggttcgcatg
catttagaatgtttactaactataattgcgttctccttcgacggcaggaatgatgctgct
caagagttttggttggaccctgacggtaatttatacggattccttcaatgggtatcgaaa
cgccaaactgttccccgggccagtgcattttgcgagatgttatgctctatttcaggtggg
gaagagaactcggccgcggcacataaattcctcattgatgaggattctctatcttctgca
aagtttcgaaggtcggcttctatgaactggacacaaatgttcgccgaaattcaactctat
gctgtgagaattactgagcgcccctcgacgacccagtcttccacactacgcctccgtaaa
ttggaagtcccagatattgaggagcccgagagcccaattatgcttaccagctacctacgt
ctcatcagccatctgtcccgggagaatagtaaaattcgtgaatggattctgcaacatcaa
accaccaacttgatctcagtacttctcactctttgcggtgcgtcaatccctcagcatctt
cgggcagctatctttgttactctgcgatgtttaatgatagaccggacgtcagcccattca
aatgaaatgtggacttctctggacaactgtatctctggctcaggctcccttccactggca
ctttctccgctaccgcccttgtctagcccacaagtacggaacgagcggcatgctttccaa
cgcatcacagagagctttgatcagatgaatgcgtttgttgaaatgcttaaccagctggtc
ggccctgtatccgattcattagattcacaattgaccctgccattccctgagtcgttgggc
tccacgtaccgaatgcctggtattgagccttacgtcgattatgtaatgggccaggctttc
gcaaacagaagtgttatggctgaagacaaggagtcacatctcttgcagtggaattgcatg
aattttgctgctaccgctctagagtccttcaacgagaatcttattagcattgtcagtcag
ccgtcaatatccgcacagccaaactggaaagtgacattctcaacataccttcgattacat
ccattttcacgtgttatggaatggctttttaacgaagatgtgctcagagtcttattttct
tgctcccacagagatgcagacggggtgtccaaggcttcttcagactccatactgatttcc
agcttggtccggagtattgatatcatgaatctaattctcgaccaccagcccacatacttc
aatattgttcgaccaataatcaaaagctccgggcaagactcttctttcaacatcgccaat
tctacccttgcatcctttgaagactgtgttattgataacttagggttgatttccgaccta
tgtctttattgcgggacggggcatcctcaactgacactaacttcactggctcttttggaa
aagctgtcagcttccagaaagttaaacaaatcttcaaacatctcgtctcgatggcaatct
acaaaccagatggttgaacagttgaactccaatgttgaagcagaccgagtagcccgatca
ctagcctcccaaatagatgtagatattcgggaactagagagtggtccagaatcatcagga
taccttattaagatgggactacttcagctactggataagtgcctcaagatgtctcctgag
aagccaacaattgctcatctccttcttggtttctcctgccttggtaataccctcgacatc
ccaccagatggcttgtttgaaaatgggatctcccttttacactctatactcgagtttgtt
aaggcttatcctcttggaatggatggggccgttatttcctggatgatacatctaagacgt
ttgggtttccaagttttactgaacctgtgggcctcacctctttcatctaatcttacttta
ccgcatctccgcgcaggtcaacttttaccagtgctcttcatgtctcaaccagttgttacc
gcagagacgttatgggacgacttccgaacaaacgagcctgatttctggctgtcatcgtcg
cccagctcgctatctgagctgctcatgctccgcactctactttatgaatatgcaacgaca
gaggtgcgggctgtgtataagcaaggctctccatctgtccagagggatactttacggaca
attctgggcacaacatcagtcgaaggtgaccagagcgtcgaacatccctctttgtttgat
ctttttgattttgctgatattgatatcgacttttcttatacatggcctgaattgcagttc
tttggtagcgtcaacgttgaaagttgcgtgaagacggaggaaaacggggtggttgtgctt
tatgacattgaagcactacaagaactccttcagctggtgaaagaggatctcgttgccgat
ggtgtagtgacatcacaaaacgaggagcaaatcatggctgaaaaggagaaacttttacta
tttttaagtgctactaacgaattccgttatgttcaatttaatcggttcgttgccttaaag
gcgtggacagagctagtgaccatcattactgtcacttgtaaaatggaccctacatacatg
gcttccttcattcagcaaacactgcaactgatactaccaaagtttgagtcatcaatagtc
gaaaccccagcggaagctattgaattggcccacctcggtgagactctcattgacaagctt
gataagatacccaccgatacaaatggggatgtgatcgatgagagattggactacttgttc
caagtctgcacaagcggcatcccgcagacgtccgacaacatcacactccgagaatctcta
tatcaaatatcctcgaaacacctcgcccggattacggcatctagttcaacagatgaccga
ttcaaggagcatgcgcacagcaccgtcaaggctgcagggcctacactcatggaaactatc
tgcgatgatgcgtatggcagcagcgagagttgcagagtctctgccctggtgttgctaaac
ctcttagggatccttgaccagcagagaaattcttccctcctggtcaacttgattacccac
tccaattatcttggaatgttcctagacgtattgagggtaatgccttcggagttccgaaat
gccaaagctacagataccgcacagctgttgctgttctacgagtcccaattatcacttctc
caacaactttcacagacgaaggctggtgcatcgcagcttctagatgctggtttattccag
gctgtgaaggaatcacagctattttctgctgatccagatataggcatagtcaccgtcttt
attaaccaggagtttttattagatatcgacaacagtgacgcacttcagcgatactatgaa
ctgcttttgtcagttctccaagtgattgtgtccactatcttctctagagggctgcataat
caggccatctgtgaccagacgagagcattcctctccgaaaacagacaaagcatggttggc
atattcaagcgatgcgcaaagagtggaagttcagatgaccctagcatgaaaaaatgcctg
gacaatctggccaaatcgtacactgcattgattgcctctgtcgactttctggacgtaagt
gcattccctctcctccgtctcttccccatccacccacaccatcctcatgcaccagaggca
tcgtacttacaaacttctgaatag

DBGET integrated database retrieval system